BLASTX nr result
ID: Scutellaria24_contig00030031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030031 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147091.1| PREDICTED: F-box/LRR-repeat protein At4g2942... 84 2e-14 ref|XP_003532461.1| PREDICTED: F-box/LRR-repeat protein At4g2942... 75 6e-12 ref|XP_002530188.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 ref|NP_194671.1| F-box/LRR-repeat protein [Arabidopsis thaliana]... 73 3e-11 dbj|BAC42265.1| unknown protein [Arabidopsis thaliana] 73 3e-11 >ref|XP_004147091.1| PREDICTED: F-box/LRR-repeat protein At4g29420-like [Cucumis sativus] gi|449503313|ref|XP_004161940.1| PREDICTED: F-box/LRR-repeat protein At4g29420-like [Cucumis sativus] Length = 449 Score = 83.6 bits (205), Expect = 2e-14 Identities = 40/73 (54%), Positives = 56/73 (76%) Frame = -3 Query: 223 ADSADLARCRVACKALNSVAPEIRSVNLHCSYIRYVKSRSPLTRSFITPFKEVFVKLISE 44 ADSADLARCRVA K++N ++ ++RSVNL CS RY+KSR+ T+ +TPFK + L++E Sbjct: 17 ADSADLARCRVASKSINVLSRDVRSVNLFCSLDRYLKSRAAETKLLVTPFKVILKTLVNE 76 Query: 43 LQIVEAVSIGVEK 5 +++VSIGVEK Sbjct: 77 FLALDSVSIGVEK 89 >ref|XP_003532461.1| PREDICTED: F-box/LRR-repeat protein At4g29420-like [Glycine max] Length = 453 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/72 (48%), Positives = 51/72 (70%) Frame = -3 Query: 220 DSADLARCRVACKALNSVAPEIRSVNLHCSYIRYVKSRSPLTRSFITPFKEVFVKLISEL 41 D+ D+ARCRV K+LN+ + E+R +NL CS RY+KSRSP T+ +TPFK V L+ Sbjct: 21 DTTDVARCRVVSKSLNAASYEVRWLNLVCSMSRYLKSRSPETKHLVTPFKTVITNLVRRS 80 Query: 40 QIVEAVSIGVEK 5 +E+VS+GV++ Sbjct: 81 GNLESVSLGVDR 92 >ref|XP_002530188.1| conserved hypothetical protein [Ricinus communis] gi|223530307|gb|EEF32202.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/75 (50%), Positives = 54/75 (72%), Gaps = 3/75 (4%) Frame = -3 Query: 220 DSADLARCRVACKALNS-VAPEIRSVNLHCSYIRYVKSRSPLTRSFITPFKEVFVKLI-- 50 DS +LARCR+ K N + +IRS+NL C+ RY+KSRSP T+ ITPFK +F +L+ Sbjct: 18 DSTELARCRLVSKTFNKLIFSDIRSINLTCTLSRYLKSRSPNTKDQITPFKRIFNRLVNR 77 Query: 49 SELQIVEAVSIGVEK 5 S+ +V++V+IGVEK Sbjct: 78 SDSLVVDSVTIGVEK 92 >ref|NP_194671.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264516|sp|Q9M0E1.1|FBL77_ARATH RecName: Full=F-box/LRR-repeat protein At4g29420 gi|7269841|emb|CAB79700.1| hypothetical protein [Arabidopsis thaliana] gi|109946621|gb|ABG48489.1| At4g29420 [Arabidopsis thaliana] gi|332660229|gb|AEE85629.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Length = 446 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/72 (50%), Positives = 51/72 (70%) Frame = -3 Query: 220 DSADLARCRVACKALNSVAPEIRSVNLHCSYIRYVKSRSPLTRSFITPFKEVFVKLISEL 41 DS LARCRVA K LNS++ E+R+VNL C++ RY+KSRS + +TPFK +F LI Sbjct: 18 DSESLARCRVASKTLNSLSREVRAVNLICTWSRYLKSRSIVV---VTPFKTIFRSLIENS 74 Query: 40 QIVEAVSIGVEK 5 + ++S+GV+K Sbjct: 75 SKIRSISVGVDK 86 >dbj|BAC42265.1| unknown protein [Arabidopsis thaliana] Length = 446 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/72 (50%), Positives = 51/72 (70%) Frame = -3 Query: 220 DSADLARCRVACKALNSVAPEIRSVNLHCSYIRYVKSRSPLTRSFITPFKEVFVKLISEL 41 DS LARCRVA K LNS++ E+R+VNL C++ RY+KSRS + +TPFK +F LI Sbjct: 18 DSESLARCRVASKTLNSLSREVRAVNLICTWSRYLKSRSIVV---VTPFKTIFRSLIENS 74 Query: 40 QIVEAVSIGVEK 5 + ++S+GV+K Sbjct: 75 SKIRSISVGVDK 86