BLASTX nr result
ID: Scutellaria24_contig00029987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00029987 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054550.1| hypothetical protein NitaCp076 [Nicotiana tabac... 61 7e-16 ref|NP_063977.1| orf146 gene product (mitochondrion) [Beta vulga... 73 3e-11 ref|YP_004842111.1| hypothetical protein BemaM_p066 [Beta macroc... 73 3e-11 ref|YP_052803.1| hypothetical protein OrniCp077 [Oryza nivara] g... 68 9e-10 ref|NP_043100.1| hypothetical protein ZemaCp099 [Zea mays] gi|50... 60 2e-07 >ref|NP_054550.1| hypothetical protein NitaCp076 [Nicotiana tabacum] gi|11466024|ref|NP_054566.1| hypothetical protein NitaCp092 [Nicotiana tabacum] gi|78102590|ref|YP_358729.1| hypothetical protein NisyCp085 [Nicotiana sylvestris] gi|78102609|ref|YP_358748.1| hypothetical protein NisyCp106 [Nicotiana sylvestris] gi|81301620|ref|YP_398915.1| hypothetical protein NitoCp084 [Nicotiana tomentosiformis] gi|81301639|ref|YP_398934.1| hypothetical protein NitoCp105 [Nicotiana tomentosiformis] gi|351653932|ref|YP_004891658.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653950|ref|YP_004891677.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11879|emb|CAA77392.1| hypothetical protein [Nicotiana tabacum] gi|1223680|emb|CAA77401.1| hypothetical protein [Nicotiana tabacum] gi|77799617|dbj|BAE46706.1| hypothetical protein [Nicotiana sylvestris] gi|77799636|dbj|BAE46725.1| hypothetical protein [Nicotiana sylvestris] gi|80750979|dbj|BAE48055.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750998|dbj|BAE48074.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453958|gb|AEO95616.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453976|gb|AEO95634.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|225249|prf||1211235CH ORF 131 Length = 131 Score = 61.2 bits (147), Expect(2) = 7e-16 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 277 VTPPLTTSFMNFIVIEIHVLPKQNL*FASLLPSRQR 170 VT PLTTSFMNFIVIEIHVLP+QNL A LLPSRQR Sbjct: 70 VTLPLTTSFMNFIVIEIHVLPRQNLELAILLPSRQR 105 Score = 47.4 bits (111), Expect(2) = 7e-16 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 170 ERMIHSDRHESPTALPESMLYI 105 ERMIHSDRHESPT LPESMLYI Sbjct: 110 ERMIHSDRHESPTTLPESMLYI 131 >ref|NP_063977.1| orf146 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435088|ref|YP_004222306.1| hypothetical protein BevumaM_p071 [Beta vulgaris subsp. maritima] gi|9049279|dbj|BAA99289.1| orf146 [Beta vulgaris subsp. vulgaris] gi|317905641|emb|CBJ14042.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439821|emb|CBJ17533.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|384977900|emb|CBL54124.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 146 Score = 72.8 bits (177), Expect = 3e-11 Identities = 43/65 (66%), Positives = 45/65 (69%), Gaps = 8/65 (12%) Frame = -2 Query: 277 VTPPLTTSFMNFIVI--EIHVLPKQNL*FASLLPSRQRKG*F------IRIDMRVQLHCQ 122 VTPPLTTSFMNFIVI EIHVLP+QN A LLPSRQR IRIDMRVQLHC Sbjct: 32 VTPPLTTSFMNFIVIVIEIHVLPRQNFELAILLPSRQRLTSVERMIHSIRIDMRVQLHCI 91 Query: 121 NPCCI 107 C+ Sbjct: 92 ARICV 96 >ref|YP_004842111.1| hypothetical protein BemaM_p066 [Beta macrocarpa] gi|345500097|emb|CBX24915.1| hypothetical protein [Beta macrocarpa] Length = 146 Score = 72.8 bits (177), Expect = 3e-11 Identities = 43/65 (66%), Positives = 45/65 (69%), Gaps = 8/65 (12%) Frame = -2 Query: 277 VTPPLTTSFMNFIVI--EIHVLPKQNL*FASLLPSRQRKG*F------IRIDMRVQLHCQ 122 VTPPLTTSFMNFIVI EIHVLP+QN A LLPSRQR IRIDMRVQLHC Sbjct: 32 VTPPLTTSFMNFIVIVIEIHVLPRQNFELAILLPSRQRLTSVERMIHSIRIDMRVQLHCI 91 Query: 121 NPCCI 107 C+ Sbjct: 92 ARICV 96 >ref|YP_052803.1| hypothetical protein OrniCp077 [Oryza nivara] gi|50234052|ref|YP_052829.1| hypothetical protein OrniCp103 [Oryza nivara] gi|49615050|dbj|BAD26833.1| unnamed protein product [Oryza nivara] gi|49615076|dbj|BAD26859.1| unnamed protein product [Oryza nivara] Length = 85 Score = 67.8 bits (164), Expect = 9e-10 Identities = 40/69 (57%), Positives = 44/69 (63%), Gaps = 8/69 (11%) Frame = -2 Query: 277 VTPPLTTSF--MNFIVIEIHVLPKQNL*FASLLPSRQRKG*FIRI------DMRVQLHCQ 122 V PLTTSF MNFIVIEIHVLP+QN A LLP+RQR R+ + LHCQ Sbjct: 17 VALPLTTSFSFMNFIVIEIHVLPRQNFELAILLPNRQRLTSVERLIHSDRYEDPTTLHCQ 76 Query: 121 NPCCIFERG 95 NPC IFE G Sbjct: 77 NPCSIFEEG 85 >ref|NP_043100.1| hypothetical protein ZemaCp099 [Zea mays] gi|50812584|ref|YP_054685.1| hypothetical protein SaofCp079 [Saccharum hybrid cultivar NCo 310] gi|50812607|ref|YP_054708.1| hypothetical protein SaofCp102 [Saccharum hybrid cultivar NCo 310] gi|902297|emb|CAA60361.1| hypothetical protein [Zea mays] gi|49659568|dbj|BAD27349.1| hypothetical protein [Saccharum hybrid cultivar NCo 310] gi|49659591|dbj|BAD27372.1| hypothetical protein [Saccharum hybrid cultivar NCo 310] Length = 58 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 6/58 (10%) Frame = -2 Query: 250 MNFIVIEIHVLPKQNL*FASLLPSRQRKG*FIRI------DMRVQLHCQNPCCIFERG 95 MNFIVIEIHVLP+QN A LLP+RQR R+ + LHCQNPC IFE G Sbjct: 1 MNFIVIEIHVLPRQNFELAILLPNRQRLTSVERLIHSDRYEDPTPLHCQNPCSIFEAG 58