BLASTX nr result
ID: Scutellaria24_contig00029959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00029959 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524419.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002524419.1| conserved hypothetical protein [Ricinus communis] gi|223536303|gb|EEF37954.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 57.4 bits (137), Expect = 1e-06 Identities = 39/89 (43%), Positives = 45/89 (50%), Gaps = 18/89 (20%) Frame = -3 Query: 314 MSMSIFSSFEAYCAESLGHKVGFS------SANKPAAPI----KVEAPKGKDVNSTPE-- 171 M MS+FSSF+A CAES G K+ FS NK AP K G+ S PE Sbjct: 1 MMMSMFSSFDALCAESSGQKLKFSVGSAIQDGNKATAPANSMKKKSGTDGERSVSPPENV 60 Query: 170 ------PARRMSGPRFAIELDGVNCFETI 102 P + PRFA E DGV+CFETI Sbjct: 61 KGSSQPPQQERRRPRFAPEFDGVHCFETI 89