BLASTX nr result
ID: Scutellaria24_contig00029829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00029829 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum... 59 1e-11 gb|ADI18616.1| hypothetical protein [uncultured Rhodospirillales... 69 3e-10 ref|ZP_06097396.1| LOW QUALITY PROTEIN: conserved hypothetical p... 54 2e-09 ref|ZP_05822977.1| LOW QUALITY PROTEIN: conserved hypothetical p... 54 2e-09 ref|ZP_06571240.1| hypothetical protein CIT292_08808 [Citrobacte... 45 5e-07 >emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] Length = 259 Score = 59.3 bits (142), Expect(2) = 1e-11 Identities = 30/45 (66%), Positives = 30/45 (66%) Frame = +1 Query: 76 GYHPLRPSFPDWFRLSLMYHWPGPRSLATTNGVSVDVLSSRYLDV 210 G P FRL HWPGPRSLATTNGVSVDVLSS YLDV Sbjct: 150 GLSPAMARLSRRFRLCKYQHWPGPRSLATTNGVSVDVLSSGYLDV 194 Score = 34.7 bits (78), Expect(2) = 1e-11 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 2 GPPMFRQDCTCPALL 46 GPPMFRQD TCPALL Sbjct: 126 GPPMFRQDFTCPALL 140 >gb|ADI18616.1| hypothetical protein [uncultured Rhodospirillales bacterium HF4000_24M03] Length = 90 Score = 69.3 bits (168), Expect = 3e-10 Identities = 37/67 (55%), Positives = 40/67 (59%) Frame = +1 Query: 1 WSPHVQTGLHVSRLTRGYIIALLVRGYHPLRPSFPDWFRLSLMYHWPGPRSLATTNGVSV 180 WSPHVQTG HVSR TR G P F L + + WPGPRSLA T+GVSV Sbjct: 24 WSPHVQTGFHVSRPTRVQQTTDTHTGLSPSMAGLSRPFWLIVCWRWPGPRSLAATDGVSV 83 Query: 181 DVLSSRY 201 DVLSS Y Sbjct: 84 DVLSSSY 90 >ref|ZP_06097396.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp. 83/13] gi|264663253|gb|EEZ33514.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp. 83/13] Length = 135 Score = 54.3 bits (129), Expect(2) = 2e-09 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +1 Query: 76 GYHPLRPSFPDWFRLSLMYHWPGPRSLATTNGVSVDVLSSRYLDV 210 G P F + F HWPGPRSLATT+GVS DVLSS YLDV Sbjct: 84 GLSPTSVEFSNSFHFIHKSHWPGPRSLATTSGVSFDVLSSGYLDV 128 Score = 32.7 bits (73), Expect(2) = 2e-09 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +2 Query: 2 GPPMFRQDCTCPALLVD 52 G PMFRQD TCPALL D Sbjct: 60 GRPMFRQDFTCPALLKD 76 >ref|ZP_05822977.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260565852|ref|ZP_05836334.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260568930|ref|ZP_05839397.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261219757|ref|ZP_05934038.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M13/05/1] gi|261313975|ref|ZP_05953172.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261316147|ref|ZP_05955344.1| LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Brucella pinnipedialis B2/94] gi|261322646|ref|ZP_05961843.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M644/93/1] gi|260095406|gb|EEW79285.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260151028|gb|EEW86124.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260154116|gb|EEW89199.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260924846|gb|EEX91414.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M13/05/1] gi|261295336|gb|EEX98832.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M644/93/1] gi|261295370|gb|EEX98866.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261303001|gb|EEY06498.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 135 Score = 54.3 bits (129), Expect(2) = 2e-09 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +1 Query: 76 GYHPLRPSFPDWFRLSLMYHWPGPRSLATTNGVSVDVLSSRYLDV 210 G P F + F HWPGPRSLATT+GVS DVLSS YLDV Sbjct: 84 GLSPTSVEFSNSFHFIHKSHWPGPRSLATTSGVSFDVLSSGYLDV 128 Score = 32.7 bits (73), Expect(2) = 2e-09 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +2 Query: 2 GPPMFRQDCTCPALLVD 52 G PMFRQD TCPALL D Sbjct: 60 GRPMFRQDFTCPALLKD 76 >ref|ZP_06571240.1| hypothetical protein CIT292_08808 [Citrobacter youngae ATCC 29220] gi|291069666|gb|EFE07775.1| hypothetical protein CIT292_08808 [Citrobacter youngae ATCC 29220] Length = 109 Score = 45.4 bits (106), Expect(2) = 5e-07 Identities = 21/38 (55%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +1 Query: 1 WSPHVQTGLHVSR--LTRGYIIALLVRGYHPLRPSFPD 108 WSPH+QTG HVSR L + VRGYHP+ +FPD Sbjct: 39 WSPHIQTGYHVSRPTLRAHNHVHFCVRGYHPVPSAFPD 76 Score = 33.1 bits (74), Expect(2) = 5e-07 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +2 Query: 134 TGLVRVRSPLLTESLLMSFPPGT 202 +GL+ VRSPLL ES L+SFP GT Sbjct: 87 SGLLPVRSPLLGESRLISFPRGT 109