BLASTX nr result
ID: Scutellaria24_contig00029771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00029771 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83839.1| hypothetical protein VITISV_023230 [Vitis vinifera] 68 7e-10 gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group] gi|... 66 3e-09 emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] 64 3e-09 gb|AAP94600.1| putative copia-like retrotransposon Hopscotch pol... 65 8e-09 gb|AAL66754.1|AF464738_5 putative copia-like retrotransposon Hop... 65 8e-09 >emb|CAN83839.1| hypothetical protein VITISV_023230 [Vitis vinifera] Length = 731 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 203 PYLRPYNGHNLQFRSHKCVFIGYSSLHKRYKCLSPSGRIYSFR 75 P+LRPYN H LQFRS KC+F+GYSS HK Y CL P G+IY R Sbjct: 101 PHLRPYNSHKLQFRSSKCLFLGYSSTHKGYLCLHPFGKIYISR 143 >gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group] gi|52353503|gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group] Length = 1447 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -1 Query: 203 PYLRPYNGHNLQFRSHKCVFIGYSSLHKRYKCLSPS-GRIYSFR 75 P+LRPYN H LQFRS +C F+GYS+LHK +KCL PS GR+Y R Sbjct: 688 PHLRPYNTHKLQFRSKQCTFLGYSTLHKGFKCLDPSTGRVYISR 731 >emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] Length = 1099 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 206 HPYLRPYNGHNLQFRSHKCVFIGYSSLHKRYKCLSPSGRIY 84 + YLRPYN H FRS KC+F+GYS HK Y+CLS SG+IY Sbjct: 478 YSYLRPYNSHKFSFRSTKCLFLGYSPXHKGYRCLSXSGQIY 518 Score = 21.9 bits (45), Expect(2) = 3e-09 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 97 VVGYTPSVSIEFAYLPFSFA 38 V+ Y P VS+ +LP SF+ Sbjct: 556 VLPYCPPVSLSSTHLPTSFS 575 >gb|AAP94600.1| putative copia-like retrotransposon Hopscotch polyprotein [Zea mays] Length = 969 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -1 Query: 203 PYLRPYNGHNLQFRSHKCVFIGYSSLHKRYKCLSPS-GRIYSFR 75 P LRPYN H LQFRS +CVF+GYSSLHK +KCL S GR+Y R Sbjct: 535 PNLRPYNSHKLQFRSKQCVFLGYSSLHKGFKCLDVSTGRVYVSR 578 >gb|AAL66754.1|AF464738_5 putative copia-like retrotransposon Hopscotch polyprotein [Zea mays] Length = 1313 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -1 Query: 203 PYLRPYNGHNLQFRSHKCVFIGYSSLHKRYKCLSPS-GRIYSFR 75 P LRPYN H LQFRS +CVF+GYSSLHK +KCL S GR+Y R Sbjct: 535 PNLRPYNSHKLQFRSKQCVFLGYSSLHKGFKCLDVSTGRVYVSR 578