BLASTX nr result
ID: Scutellaria24_contig00029286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00029286 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat... 144 6e-33 emb|CBI38188.3| unnamed protein product [Vitis vinifera] 144 6e-33 emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] 144 6e-33 ref|XP_004152153.1| PREDICTED: putative pentatricopeptide repeat... 139 2e-31 ref|XP_002512645.1| pentatricopeptide repeat-containing protein,... 138 5e-31 >ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Vitis vinifera] Length = 611 Score = 144 bits (364), Expect = 6e-33 Identities = 63/98 (64%), Positives = 82/98 (83%) Frame = -1 Query: 295 VGDDSHQDIKLIRGMLEWLNFRSKTVGYTPDHNAVLLDVEEDEKSRLLWLHSERIALAFA 116 VGD SH ++++I GMLEWL+ ++K GY P++N VLLDVE++EK RLLW+HSER+AL+F Sbjct: 493 VGDTSHPEVRVINGMLEWLHMKTKKAGYIPNYNVVLLDVEDEEKERLLWVHSERLALSFG 552 Query: 115 LLRTPPGSPIRIFKNLRICADCHVALKFVSKLVDREIV 2 ++RTP GSPIRI KNLRIC DCH A+K +SK+V REIV Sbjct: 553 IIRTPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIV 590 >emb|CBI38188.3| unnamed protein product [Vitis vinifera] Length = 744 Score = 144 bits (364), Expect = 6e-33 Identities = 63/98 (64%), Positives = 82/98 (83%) Frame = -1 Query: 295 VGDDSHQDIKLIRGMLEWLNFRSKTVGYTPDHNAVLLDVEEDEKSRLLWLHSERIALAFA 116 VGD SH ++++I GMLEWL+ ++K GY P++N VLLDVE++EK RLLW+HSER+AL+F Sbjct: 626 VGDTSHPEVRVINGMLEWLHMKTKKAGYIPNYNVVLLDVEDEEKERLLWVHSERLALSFG 685 Query: 115 LLRTPPGSPIRIFKNLRICADCHVALKFVSKLVDREIV 2 ++RTP GSPIRI KNLRIC DCH A+K +SK+V REIV Sbjct: 686 IIRTPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIV 723 >emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] Length = 787 Score = 144 bits (364), Expect = 6e-33 Identities = 63/98 (64%), Positives = 82/98 (83%) Frame = -1 Query: 295 VGDDSHQDIKLIRGMLEWLNFRSKTVGYTPDHNAVLLDVEEDEKSRLLWLHSERIALAFA 116 VGD SH ++++I GMLEWL+ ++K GY P++N VLLDVE++EK RLLW+HSER+AL+F Sbjct: 669 VGDTSHPEVRVINGMLEWLHMKTKKAGYIPNYNVVLLDVEDEEKERLLWVHSERLALSFG 728 Query: 115 LLRTPPGSPIRIFKNLRICADCHVALKFVSKLVDREIV 2 ++RTP GSPIRI KNLRIC DCH A+K +SK+V REIV Sbjct: 729 IIRTPSGSPIRIMKNLRICVDCHAAIKCISKVVQREIV 766 >ref|XP_004152153.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Cucumis sativus] gi|449515059|ref|XP_004164567.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Cucumis sativus] Length = 721 Score = 139 bits (351), Expect = 2e-31 Identities = 64/98 (65%), Positives = 78/98 (79%) Frame = -1 Query: 295 VGDDSHQDIKLIRGMLEWLNFRSKTVGYTPDHNAVLLDVEEDEKSRLLWLHSERIALAFA 116 V D SH D+KLI GMLE+LN +++ GY+P NAVLLDVE+DEK RLLWLHSER+ALAF Sbjct: 603 VADTSHADLKLINGMLEFLNMKTRKAGYSPQLNAVLLDVEDDEKERLLWLHSERLALAFG 662 Query: 115 LLRTPPGSPIRIFKNLRICADCHVALKFVSKLVDREIV 2 L+R P G PIRI KNLRIC DCH +K +SK+V R+I+ Sbjct: 663 LVRMPAGCPIRIIKNLRICVDCHSVIKLISKIVGRDII 700 >ref|XP_002512645.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548606|gb|EEF50097.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 716 Score = 138 bits (347), Expect = 5e-31 Identities = 63/98 (64%), Positives = 77/98 (78%) Frame = -1 Query: 295 VGDDSHQDIKLIRGMLEWLNFRSKTVGYTPDHNAVLLDVEEDEKSRLLWLHSERIALAFA 116 VGD SH D+K+I GMLEWLN +++ GY PD NAVL DVE+DEK R LW+HSER+ALAF Sbjct: 598 VGDTSHPDMKMISGMLEWLNMKTEKAGYVPDLNAVLRDVEDDEKKRHLWVHSERLALAFG 657 Query: 115 LLRTPPGSPIRIFKNLRICADCHVALKFVSKLVDREIV 2 L+RTP IRI KNLRIC DCH A+K +SK+V R+I+ Sbjct: 658 LIRTPSRGHIRILKNLRICTDCHSAIKLISKIVQRDII 695