BLASTX nr result
ID: Scutellaria24_contig00029213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00029213 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138260.1| PREDICTED: adenine/guanine permease AZG2-lik... 56 3e-06 ref|XP_002511257.1| purine permease, putative [Ricinus communis]... 56 4e-06 >ref|XP_004138260.1| PREDICTED: adenine/guanine permease AZG2-like [Cucumis sativus] gi|449531747|ref|XP_004172847.1| PREDICTED: adenine/guanine permease AZG2-like [Cucumis sativus] Length = 554 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/70 (42%), Positives = 41/70 (58%) Frame = -2 Query: 286 TMILMPLTYSXXXXXXXXXXXXXXXGLYDNVVEWIKWLIKMRRVMVREENQVSAAAVFAA 107 TM+LMPLTYS LYDNV+ +KWL+KM++V+ E+NQVSA A Sbjct: 490 TMVLMPLTYSIANGIVGGIGVYVALSLYDNVLRLMKWLMKMKKVVATEQNQVSATAA--- 546 Query: 106 KHNLEVV*VI 77 N E++ V+ Sbjct: 547 --NTELISVV 554 >ref|XP_002511257.1| purine permease, putative [Ricinus communis] gi|223550372|gb|EEF51859.1| purine permease, putative [Ricinus communis] Length = 546 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = -2 Query: 286 TMILMPLTYSXXXXXXXXXXXXXXXGLYDNVVEWIKWLIKMRRVMVREENQVSAAA 119 T++LMPLTYS +YD VV +WLIKMRR++V+E+NQVSAAA Sbjct: 482 TILLMPLTYSIANGIIGGIGIYVALNMYDYVVRLARWLIKMRRMVVKEQNQVSAAA 537