BLASTX nr result
ID: Scutellaria24_contig00029044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00029044 (538 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79370.1| hypothetical protein VITISV_018588 [Vitis vinifera] 74 1e-11 gb|AAG51263.1|AC027135_4 unknown protein [Arabidopsis thaliana] 74 2e-11 ref|NP_174433.2| protein shoot gravitropism 2 (SGR2) [Arabidopsi... 74 2e-11 ref|XP_004171664.1| PREDICTED: SEC23-interacting protein-like, p... 73 2e-11 ref|XP_004138828.1| PREDICTED: SEC23-interacting protein-like [C... 73 2e-11 >emb|CAN79370.1| hypothetical protein VITISV_018588 [Vitis vinifera] Length = 331 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = +2 Query: 383 GTGADAVEQTSPDSLKNTPSNIRRLANEIEQCEERQKYLAHTRSPSDGGDVR 538 G+G+ E TS + LKNTPSNI RL ++IE CEERQKYLA TRSPSDG DVR Sbjct: 33 GSGSCEAEGTSVELLKNTPSNIARLEDQIEHCEERQKYLAQTRSPSDGSDVR 84 >gb|AAG51263.1|AC027135_4 unknown protein [Arabidopsis thaliana] Length = 869 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = +2 Query: 389 GADAVEQTSPDSLKNTPSNIRRLANEIEQCEERQKYLAHTRSPSDGGDVR 538 G V +TSPD LKNTPSNI RL + IEQC RQKYLA TRSPSDG DVR Sbjct: 9 GTREVNETSPDLLKNTPSNIARLEDVIEQCHGRQKYLAQTRSPSDGSDVR 58 >ref|NP_174433.2| protein shoot gravitropism 2 (SGR2) [Arabidopsis thaliana] gi|16904659|dbj|BAB71959.1| shoot gravitropism 2 [Arabidopsis thaliana] gi|332193239|gb|AEE31360.1| protein shoot gravitropism 2 (SGR2) [Arabidopsis thaliana] Length = 933 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = +2 Query: 389 GADAVEQTSPDSLKNTPSNIRRLANEIEQCEERQKYLAHTRSPSDGGDVR 538 G V +TSPD LKNTPSNI RL + IEQC RQKYLA TRSPSDG DVR Sbjct: 9 GTREVNETSPDLLKNTPSNIARLEDVIEQCHGRQKYLAQTRSPSDGSDVR 58 >ref|XP_004171664.1| PREDICTED: SEC23-interacting protein-like, partial [Cucumis sativus] Length = 115 Score = 73.2 bits (178), Expect = 2e-11 Identities = 39/63 (61%), Positives = 43/63 (68%), Gaps = 8/63 (12%) Frame = +2 Query: 374 DMGGT--------GADAVEQTSPDSLKNTPSNIRRLANEIEQCEERQKYLAHTRSPSDGG 529 DMGG G+ V + SPDSLKNTPSNI +L + IE C RQKYLA TRSPSDGG Sbjct: 8 DMGGDDMLISAAIGSIEVPEASPDSLKNTPSNIAKLEDVIEHCVGRQKYLAQTRSPSDGG 67 Query: 530 DVR 538 DVR Sbjct: 68 DVR 70 >ref|XP_004138828.1| PREDICTED: SEC23-interacting protein-like [Cucumis sativus] Length = 945 Score = 73.2 bits (178), Expect = 2e-11 Identities = 39/63 (61%), Positives = 43/63 (68%), Gaps = 8/63 (12%) Frame = +2 Query: 374 DMGGT--------GADAVEQTSPDSLKNTPSNIRRLANEIEQCEERQKYLAHTRSPSDGG 529 DMGG G+ V + SPDSLKNTPSNI +L + IE C RQKYLA TRSPSDGG Sbjct: 8 DMGGDDMLISAAIGSIEVPEASPDSLKNTPSNIAKLEDVIEHCVGRQKYLAQTRSPSDGG 67 Query: 530 DVR 538 DVR Sbjct: 68 DVR 70