BLASTX nr result
ID: Scutellaria24_contig00028876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028876 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 104 6e-21 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 104 bits (260), Expect = 6e-21 Identities = 57/80 (71%), Positives = 61/80 (76%) Frame = +1 Query: 1 PRYRTCDSHRIRLAQRLLNPSRAFSSTSPLSNPRSNLRSPGAMKWGVFPSPIVCIGLASS 180 PRYRTCDSHRIRLAQRLLNPSRAFSST PL + L + GVFPSPIVCIGLASS Sbjct: 30 PRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQS-SIKLAFSRRSEMGVFPSPIVCIGLASS 88 Query: 181 RTKEAFWRTHACRKADDYIS 240 R+K + R ACRKAD YIS Sbjct: 89 RSK-LYLRARACRKADHYIS 107