BLASTX nr result
ID: Scutellaria24_contig00028497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028497 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533624.1| kinase, putative [Ricinus communis] gi|22352... 56 3e-06 >ref|XP_002533624.1| kinase, putative [Ricinus communis] gi|223526482|gb|EEF28753.1| kinase, putative [Ricinus communis] Length = 370 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 96 LDASLPQVSKGGNSPFTYIIVDDQTKTRTCIH 1 +D S VSKGGNSPFTY+IVD QTKTRTCIH Sbjct: 93 VDTSFLVVSKGGNSPFTYVIVDSQTKTRTCIH 124