BLASTX nr result
ID: Scutellaria24_contig00028283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028283 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007353954.1| ribosomal protein L22 (chloroplast) [Tectona... 55 6e-06 >ref|YP_007353954.1| ribosomal protein L22 (chloroplast) [Tectona grandis] gi|438687643|emb|CCP47170.1| ribosomal protein L22 (chloroplast) [Tectona grandis] gi|438688327|emb|CCP47259.1| ribosomal protein L22 (chloroplast) [Tectona grandis] gi|438688451|emb|CCP47348.1| ribosomal protein L22 (chloroplast) [Tectona grandis] Length = 154 Score = 55.1 bits (131), Expect = 6e-06 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -3 Query: 170 KKATCHITIVVKDIFSNSSEDILCFYSLKNHRRKRKATIVYH-MYNS-IVW 24 KKATCHITIVVKDI + E++ FYSLKN R K K T+VYH +YNS +VW Sbjct: 103 KKATCHITIVVKDISLDEYEEVY-FYSLKNPRWK-KTTMVYHDVYNSEVVW 151