BLASTX nr result
ID: Scutellaria24_contig00028242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028242 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002881563.1| proton-dependent oligopeptide transport fami... 57 2e-06 ref|NP_181345.1| proton-dependent oligopeptide transport-like pr... 55 6e-06 ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Gly... 55 8e-06 >ref|XP_002881563.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297327402|gb|EFH57822.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Length = 521 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/81 (38%), Positives = 44/81 (54%) Frame = -3 Query: 247 KRCGSKIGITISMIFSVACCLSAGGVEMWRLRVVRKHGLVEKADEVVPLSAYWLFFQFFL 68 K+ + GI +S+I S+ CC A VE RL+VVR GL+ E VP+S +WL Q+ L Sbjct: 351 KQTKTPYGIPVSIILSIFCCSIAAHVESRRLKVVRTQGLLY---ETVPMSVFWLLPQYIL 407 Query: 67 LSGMDAFFETSSASLITYQAP 5 L + +E S A + P Sbjct: 408 LGSITGIYENSFALYLEETVP 428 >ref|NP_181345.1| proton-dependent oligopeptide transport-like protein [Arabidopsis thaliana] gi|75223187|sp|O80436.1|PTR29_ARATH RecName: Full=Putative peptide/nitrate transporter At2g38100 gi|3335358|gb|AAC27159.1| putative peptide/amino acid transporter [Arabidopsis thaliana] gi|330254395|gb|AEC09489.1| proton-dependent oligopeptide transport-like protein [Arabidopsis thaliana] Length = 521 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/81 (37%), Positives = 43/81 (53%) Frame = -3 Query: 247 KRCGSKIGITISMIFSVACCLSAGGVEMWRLRVVRKHGLVEKADEVVPLSAYWLFFQFFL 68 K+ + GI +S+I S+ CC A VE RL+VV GL+ E VP+S +WL Q+ L Sbjct: 351 KQTKTPYGIPVSIILSIFCCSIAAHVESRRLKVVSTQGLLH---ETVPMSVFWLLPQYIL 407 Query: 67 LSGMDAFFETSSASLITYQAP 5 L + +E S A + P Sbjct: 408 LGSITGIYENSFALYLEETVP 428 >ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Glycine max] Length = 594 Score = 54.7 bits (130), Expect = 8e-06 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 12/96 (12%) Frame = -3 Query: 298 VFFLGKMLFFL-IAEYVVKRCGSKIG-----------ITISMIFSVACCLSAGGVEMWRL 155 VFF+G +L + + + V+ K+ I + ++FS+ +SA +E+ RL Sbjct: 388 VFFVGSVLLTVPVYDRVITPIAKKLSHNPQGLTPLQRIGVGLVFSILAMVSAALIEIKRL 447 Query: 154 RVVRKHGLVEKADEVVPLSAYWLFFQFFLLSGMDAF 47 R+ R +GL K + VVP+S +WL QFF + +AF Sbjct: 448 RMARANGLAHKHNAVVPISVFWLVPQFFFVGSGEAF 483