BLASTX nr result
ID: Scutellaria24_contig00028215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028215 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW72356.1| hypothetical protein TREMEDRAFT_26101, partial [T... 63 3e-08 ref|XP_772216.1| hypothetical protein CNBM0490 [Cryptococcus neo... 63 3e-08 ref|XP_775277.1| hypothetical protein CNBE2950 [Cryptococcus neo... 63 3e-08 ref|XP_003606104.1| Aspartyl-tRNA synthetase [Medicago truncatul... 62 5e-08 ref|XP_776516.1| hypothetical protein CNBC4420 [Cryptococcus neo... 61 8e-08 >gb|EIW72356.1| hypothetical protein TREMEDRAFT_26101, partial [Tremella mesenterica DSM 1558] Length = 532 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 208 GNLDNRRSLTGYIFKLFGITISWKSMQQPVVALSTTEAEY 327 G+LD RRS TGY+FK++G ++WKS +QP VALSTTEAEY Sbjct: 385 GDLDTRRSTTGYVFKVYGGVVAWKSRRQPTVALSTTEAEY 424 >ref|XP_772216.1| hypothetical protein CNBM0490 [Cryptococcus neoformans var. neoformans B-3501A] gi|50254825|gb|EAL17569.1| hypothetical protein CNBM0490 [Cryptococcus neoformans var. neoformans B-3501A] Length = 1242 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 208 GNLDNRRSLTGYIFKLFGITISWKSMQQPVVALSTTEAEY 327 G+LD RRS TGY+FK++G + WKS +QP VALSTTEAEY Sbjct: 1090 GDLDTRRSTTGYVFKIYGGVVGWKSKRQPTVALSTTEAEY 1129 >ref|XP_775277.1| hypothetical protein CNBE2950 [Cryptococcus neoformans var. neoformans B-3501A] gi|50257933|gb|EAL20630.1| hypothetical protein CNBE2950 [Cryptococcus neoformans var. neoformans B-3501A] Length = 297 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 208 GNLDNRRSLTGYIFKLFGITISWKSMQQPVVALSTTEAEY 327 G+LD RRS TGY+FK++G + WKS +QP VALSTTEAEY Sbjct: 145 GDLDTRRSTTGYVFKIYGGVVGWKSKRQPTVALSTTEAEY 184 >ref|XP_003606104.1| Aspartyl-tRNA synthetase [Medicago truncatula] gi|355507159|gb|AES88301.1| Aspartyl-tRNA synthetase [Medicago truncatula] Length = 803 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +1 Query: 208 GNLDNRRSLTGYIFKLFGITISWKSMQQPVVALSTTEAEY 327 GN+D R+SL+G++F L+G TISWK+ QQ VVALSTT+AEY Sbjct: 16 GNVDTRKSLSGFVFTLYGTTISWKANQQSVVALSTTQAEY 55 >ref|XP_776516.1| hypothetical protein CNBC4420 [Cryptococcus neoformans var. neoformans B-3501A] gi|50259194|gb|EAL21869.1| hypothetical protein CNBC4420 [Cryptococcus neoformans var. neoformans B-3501A] Length = 868 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 208 GNLDNRRSLTGYIFKLFGITISWKSMQQPVVALSTTEAEY 327 G+LD RRS TGY+FK+ G + WKS +QP VALSTTEAEY Sbjct: 705 GDLDTRRSTTGYVFKIHGGVVGWKSKRQPTVALSTTEAEY 744