BLASTX nr result
ID: Scutellaria24_contig00028103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028103 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein P... 103 2e-20 ref|XP_003517589.1| PREDICTED: homeobox-leucine zipper protein M... 77 1e-12 ref|XP_003538765.1| PREDICTED: homeobox-leucine zipper protein M... 74 1e-11 ref|XP_002518520.1| homeobox protein, putative [Ricinus communis... 73 3e-11 gb|AFO11041.1| HD-1A [Gossypium hirsutum] 72 4e-11 >ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Vitis vinifera] gi|302144076|emb|CBI23181.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 103 bits (256), Expect = 2e-20 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +3 Query: 324 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQR 488 MFQPNMFDSHHHLLDM HKTPE+EM IRD+E+ESKSGT+ M+APSGDDQDPNQR Sbjct: 1 MFQPNMFDSHHHLLDMPHKTPESEMGKIRDEEFESKSGTENMDAPSGDDQDPNQR 55 >ref|XP_003517589.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Glycine max] Length = 731 Score = 77.0 bits (188), Expect = 1e-12 Identities = 41/60 (68%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = +3 Query: 324 MFQPNMFDSHHHLLDMG--HKTPENEMDLI---RDDEYESKSGTDIMEAPSGDDQDPNQR 488 MF NMFDSH HLLDM HKT +E DL RDDEYE+KS TD M+APSGDDQDPN R Sbjct: 1 MFDTNMFDSHPHLLDMSPPHKTTCSESDLAKPCRDDEYETKSITDTMDAPSGDDQDPNPR 60 >ref|XP_003538765.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Glycine max] Length = 732 Score = 73.9 bits (180), Expect = 1e-11 Identities = 41/60 (68%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = +3 Query: 324 MFQPNMFDSHHHLLDMG-HKTPE-NEMDL---IRDDEYESKSGTDIMEAPSGDDQDPNQR 488 MF NMFDSH HLLDM HKT +E DL RDDEYE+KS TD M+APSGDDQDPN R Sbjct: 1 MFHANMFDSHPHLLDMSPHKTTACSESDLGKACRDDEYETKSITDAMDAPSGDDQDPNPR 60 >ref|XP_002518520.1| homeobox protein, putative [Ricinus communis] gi|223542365|gb|EEF43907.1| homeobox protein, putative [Ricinus communis] Length = 727 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/57 (61%), Positives = 45/57 (78%), Gaps = 2/57 (3%) Frame = +3 Query: 324 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEY--ESKSGTDIMEAPSGDDQDPNQR 488 MFQP +F+SHH + DM K+ ENE+ ++DD+Y E+KSGT+ EAPSGDDQDPNQR Sbjct: 1 MFQPALFESHH-MFDMTPKSSENELGNLKDDDYDHETKSGTETTEAPSGDDQDPNQR 56 >gb|AFO11041.1| HD-1A [Gossypium hirsutum] Length = 725 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/56 (62%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +3 Query: 324 MFQPNMFDSHHHLLDMGHKTPENE-MDLIRDDEYESKSGTDIMEAPSGDDQDPNQR 488 MF PN+F+S H + DM HKT E+E M +RDD+YE KS T+ M+APSGDDQDP+QR Sbjct: 1 MFSPNLFESPH-MFDMSHKTSESELMGKVRDDDYEIKSVTETMDAPSGDDQDPDQR 55