BLASTX nr result
ID: Scutellaria24_contig00028086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028086 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75301.1| hypothetical protein VITISV_008678 [Vitis vinifera] 43 2e-07 >emb|CAN75301.1| hypothetical protein VITISV_008678 [Vitis vinifera] Length = 248 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +2 Query: 5 DPQWYFDSGATSHVTASLDNLSVKTEHKGPEQLIV 109 D WY DSGAT+HV A L NL +K+ + G ++L+V Sbjct: 144 DQSWYDDSGATNHVIAELGNLLMKSNYHGEDKLVV 178 Score = 37.4 bits (85), Expect(2) = 2e-07 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +3 Query: 102 LL*DKFTHKTLLEGKLKDGLYQLDLSHVLLNKNFSEITSSS 224 L+ DK H+ LL+GKL+DGLY+L H+ KN ++ T++S Sbjct: 195 LVKDKENHQVLLQGKLEDGLYKL---HIYETKNHTKPTANS 232