BLASTX nr result
ID: Scutellaria24_contig00028084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00028084 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGB85033.1| senescence-associated protein, partial [Auxenochl... 74 1e-11 >gb|AGB85033.1| senescence-associated protein, partial [Auxenochlorella protothecoides] Length = 178 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +2 Query: 95 ENDSAPSIASSLEAFSG*LTDGSVAPTPFQASALPIIRTGGSSRTEPDYYGGV 253 E D APS AS LEAFS TDGS+AP+P QASALPIIRT GSSRTE DYYGG+ Sbjct: 5 EWDPAPSTASDLEAFSR-PTDGSLAPSPGQASALPIIRTDGSSRTESDYYGGI 56