BLASTX nr result
ID: Scutellaria24_contig00027941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00027941 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267632.1| PREDICTED: leucine-rich repeat receptor-like... 119 2e-25 ref|XP_003556401.1| PREDICTED: probable leucine-rich repeat rece... 115 5e-24 ref|XP_003536190.1| PREDICTED: LRR receptor-like serine/threonin... 112 3e-23 ref|XP_003548248.1| PREDICTED: somatic embryogenesis receptor ki... 112 4e-23 ref|XP_003534047.1| PREDICTED: probable leucine-rich repeat rece... 109 3e-22 >ref|XP_002267632.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 [Vitis vinifera] Length = 681 Score = 119 bits (299), Expect = 2e-25 Identities = 53/64 (82%), Positives = 57/64 (89%) Frame = +2 Query: 95 NLHLGSWVVSGDPCDGTFEGVACNERGNVVNISLQGKGLAGKLSPAVGGLKHLTGLYLHY 274 NL L SW ++GDPCDG+FEGVACNERG V NISLQGKGL GKLSPA+ GLKHLTGLYLHY Sbjct: 42 NLFLSSWTINGDPCDGSFEGVACNERGQVANISLQGKGLTGKLSPAIAGLKHLTGLYLHY 101 Query: 275 NSLY 286 NSLY Sbjct: 102 NSLY 105 >ref|XP_003556401.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Glycine max] Length = 677 Score = 115 bits (287), Expect = 5e-24 Identities = 49/64 (76%), Positives = 58/64 (90%) Frame = +2 Query: 95 NLHLGSWVVSGDPCDGTFEGVACNERGNVVNISLQGKGLAGKLSPAVGGLKHLTGLYLHY 274 +L+L SW ++GDPCDG+FEG+ACNE+G V N+SLQGKGL GKLSPA+ GLKHLTGLYLHY Sbjct: 42 SLYLPSWSINGDPCDGSFEGIACNEKGQVANVSLQGKGLLGKLSPAIAGLKHLTGLYLHY 101 Query: 275 NSLY 286 NSLY Sbjct: 102 NSLY 105 >ref|XP_003536190.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Glycine max] Length = 677 Score = 112 bits (280), Expect = 3e-23 Identities = 50/64 (78%), Positives = 57/64 (89%) Frame = +2 Query: 95 NLHLGSWVVSGDPCDGTFEGVACNERGNVVNISLQGKGLAGKLSPAVGGLKHLTGLYLHY 274 +L+L SW ++GDPCDG+FEGVACNE+G V NISLQGKGL GKLS A+ GLKHLTGLYLHY Sbjct: 42 SLYLPSWSINGDPCDGSFEGVACNEKGQVANISLQGKGLFGKLSAAIAGLKHLTGLYLHY 101 Query: 275 NSLY 286 NSLY Sbjct: 102 NSLY 105 >ref|XP_003548248.1| PREDICTED: somatic embryogenesis receptor kinase 4-like [Glycine max] Length = 684 Score = 112 bits (279), Expect = 4e-23 Identities = 48/61 (78%), Positives = 55/61 (90%) Frame = +2 Query: 104 LGSWVVSGDPCDGTFEGVACNERGNVVNISLQGKGLAGKLSPAVGGLKHLTGLYLHYNSL 283 L SW + G+PCDG+FEGVACNE+G V N+SLQGKGL+GKLSPA+ GLKHLTGLYLHYNSL Sbjct: 48 LSSWTMGGNPCDGSFEGVACNEKGQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSL 107 Query: 284 Y 286 Y Sbjct: 108 Y 108 >ref|XP_003534047.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Glycine max] Length = 683 Score = 109 bits (272), Expect = 3e-22 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = +2 Query: 104 LGSWVVSGDPCDGTFEGVACNERGNVVNISLQGKGLAGKLSPAVGGLKHLTGLYLHYNSL 283 L SW + G PC G+FEGVACNE+G V N+SLQGKGL+GKLSPA+ GLKHLTGLYLHYNSL Sbjct: 47 LSSWTIDGTPCGGSFEGVACNEKGQVANVSLQGKGLSGKLSPAIAGLKHLTGLYLHYNSL 106 Query: 284 Y 286 Y Sbjct: 107 Y 107