BLASTX nr result
ID: Scutellaria24_contig00027899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00027899 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF17698.1|AC009243_25 F28K19.15 [Arabidopsis thaliana] 57 2e-06 >gb|AAF17698.1|AC009243_25 F28K19.15 [Arabidopsis thaliana] Length = 332 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 113 KEVEHTCESADNVDLGTACGKYFRVSCLSIIDPG 12 K+ +C DNVDLGTACGKYFRVSCLSI+DPG Sbjct: 113 KDSLFSCFCEDNVDLGTACGKYFRVSCLSIVDPG 146