BLASTX nr result
ID: Scutellaria24_contig00027710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00027710 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626194.1| F-box protein PP2-B15 [Medicago truncatula] ... 62 5e-08 ref|XP_002529282.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 gb|AAC24090.1| Contains similarity to phloem-specific lectin PP2... 57 1e-06 ref|NP_563837.1| F-box protein PP2-B15 [Arabidopsis thaliana] gi... 57 1e-06 ref|XP_002892485.1| phloem protein 2-B15 [Arabidopsis lyrata sub... 57 1e-06 >ref|XP_003626194.1| F-box protein PP2-B15 [Medicago truncatula] gi|355501209|gb|AES82412.1| F-box protein PP2-B15 [Medicago truncatula] Length = 306 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +1 Query: 1 GKINIGMLSPNTTYGAYLVMRLMDRAFGLDVEASQVLVQVGSYKAQKTLYLK 156 G IN MLSP T YGAYL +++ DRA+GLD S+V ++VG+YK+Q+ +Y++ Sbjct: 141 GSINSEMLSPKTMYGAYLKVKIADRAYGLDSLPSEVSIEVGNYKSQENVYIR 192 >ref|XP_002529282.1| conserved hypothetical protein [Ricinus communis] gi|223531271|gb|EEF33114.1| conserved hypothetical protein [Ricinus communis] Length = 272 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +1 Query: 1 GKINIGMLSPNTTYGAYLVMRLMDRAFGLDVEASQVLVQVGSYKAQKTLYLK 156 GKI MLSPNT YGAYL+M++ DRA+GLD S++ V+VG+ + +L+ Sbjct: 138 GKIRTQMLSPNTKYGAYLIMKISDRAYGLDSMPSEISVEVGNQVSSSITHLR 189 >gb|AAC24090.1| Contains similarity to phloem-specific lectin PP2 gb|Z17331 from Cucubita maxima [Arabidopsis thaliana] Length = 288 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +1 Query: 1 GKINIGMLSPNTTYGAYLVMRLMDRAFGLDVEASQVLVQVGS-YKAQKTLYLKC 159 GKI G LSPNT YGAYL+M++ RA+GLD+ ++ ++VG+ K K+ YL C Sbjct: 139 GKIQTGALSPNTNYGAYLIMKVTSRAYGLDLVPAETSIKVGNGEKKIKSTYLSC 192 >ref|NP_563837.1| F-box protein PP2-B15 [Arabidopsis thaliana] gi|334302842|sp|O80494.2|P2B15_ARATH RecName: Full=F-box protein PP2-B15; AltName: Full=Protein PHLOEM PROTEIN 2-LIKE B15; Short=AtPP2-B15 gi|332190282|gb|AEE28403.1| F-box protein PP2-B15 [Arabidopsis thaliana] Length = 289 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +1 Query: 1 GKINIGMLSPNTTYGAYLVMRLMDRAFGLDVEASQVLVQVGS-YKAQKTLYLKC 159 GKI G LSPNT YGAYL+M++ RA+GLD+ ++ ++VG+ K K+ YL C Sbjct: 140 GKIQTGALSPNTNYGAYLIMKVTSRAYGLDLVPAETSIKVGNGEKKIKSTYLSC 193 >ref|XP_002892485.1| phloem protein 2-B15 [Arabidopsis lyrata subsp. lyrata] gi|297338327|gb|EFH68744.1| phloem protein 2-B15 [Arabidopsis lyrata subsp. lyrata] Length = 289 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/73 (42%), Positives = 48/73 (65%), Gaps = 6/73 (8%) Frame = +1 Query: 1 GKINIGMLSPNTTYGAYLVMRLMDRAFGLDVEASQVLVQVGS-YKAQKTLYLKCDLCKGQ 177 GKI G+LSPNT YGAYL+M++ RA+GLD+ ++ ++VG+ K ++ YL C K Q Sbjct: 140 GKIQTGVLSPNTNYGAYLIMKVTSRAYGLDLVPAETSIKVGNCEKKIRSTYLSCLDNKKQ 199 Query: 178 GL-----KEREKR 201 + ++RE+R Sbjct: 200 QMERMFYRQREQR 212