BLASTX nr result
ID: Scutellaria24_contig00027479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00027479 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597936.1| Sodium-coupled neutral amino acid transporte... 99 5e-19 ref|XP_002530469.1| amino acid transporter, putative [Ricinus co... 99 5e-19 ref|XP_003546923.1| PREDICTED: sodium-coupled neutral amino acid... 97 1e-18 ref|XP_003543691.1| PREDICTED: sodium-coupled neutral amino acid... 97 1e-18 emb|CBI36435.3| unnamed protein product [Vitis vinifera] 97 1e-18 >ref|XP_003597936.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] gi|355486984|gb|AES68187.1| Sodium-coupled neutral amino acid transporter [Medicago truncatula] Length = 496 Score = 98.6 bits (244), Expect = 5e-19 Identities = 54/78 (69%), Positives = 58/78 (74%) Frame = -2 Query: 234 GSGISGAVFNLTTSIIGAGIMALPATMKXXXXXXXXXXXXXXXXLSEISVELLVRFSVQC 55 GSG+ GAVFNLTT+IIGAGIMALPATMK LSEISVELLVRFSV C Sbjct: 74 GSGVPGAVFNLTTTIIGAGIMALPATMKVLGVVLGIVLIILMGVLSEISVELLVRFSVMC 133 Query: 54 KATSYGEIVQAALGRTAR 1 KA+SYGE+VQ ALGR AR Sbjct: 134 KASSYGEVVQHALGRPAR 151 >ref|XP_002530469.1| amino acid transporter, putative [Ricinus communis] gi|223530014|gb|EEF31939.1| amino acid transporter, putative [Ricinus communis] Length = 497 Score = 98.6 bits (244), Expect = 5e-19 Identities = 53/78 (67%), Positives = 59/78 (75%) Frame = -2 Query: 234 GSGISGAVFNLTTSIIGAGIMALPATMKXXXXXXXXXXXXXXXXLSEISVELLVRFSVQC 55 GSGI GAVFNLTTSIIGAGIMALPATMK LSE+SVE+LVRFSV C Sbjct: 82 GSGIYGAVFNLTTSIIGAGIMALPATMKVLGLILGVLLIVLMGILSEVSVEMLVRFSVLC 141 Query: 54 KATSYGEIVQAALGRTAR 1 KA+SYGE+VQ ALG+TA+ Sbjct: 142 KASSYGEVVQCALGKTAK 159 >ref|XP_003546923.1| PREDICTED: sodium-coupled neutral amino acid transporter 4-like [Glycine max] Length = 485 Score = 97.1 bits (240), Expect = 1e-18 Identities = 53/78 (67%), Positives = 58/78 (74%) Frame = -2 Query: 234 GSGISGAVFNLTTSIIGAGIMALPATMKXXXXXXXXXXXXXXXXLSEISVELLVRFSVQC 55 GSGI GAVFNLTT++IGAGIMALPATMK LSEISVELLVRFSV C Sbjct: 72 GSGIPGAVFNLTTTVIGAGIMALPATMKVLGVVLGIVLIIIMGILSEISVELLVRFSVLC 131 Query: 54 KATSYGEIVQAALGRTAR 1 KA+SYGE+VQ A+GR AR Sbjct: 132 KASSYGEVVQHAMGRPAR 149 >ref|XP_003543691.1| PREDICTED: sodium-coupled neutral amino acid transporter 4-like [Glycine max] Length = 485 Score = 97.1 bits (240), Expect = 1e-18 Identities = 53/78 (67%), Positives = 58/78 (74%) Frame = -2 Query: 234 GSGISGAVFNLTTSIIGAGIMALPATMKXXXXXXXXXXXXXXXXLSEISVELLVRFSVQC 55 GSGI GAVFNLTT++IGAGIMALPATMK LSEISVELLVRFSV C Sbjct: 72 GSGIPGAVFNLTTTVIGAGIMALPATMKVLGVVLGIVLIVLMGILSEISVELLVRFSVLC 131 Query: 54 KATSYGEIVQAALGRTAR 1 KA+SYGE+VQ A+GR AR Sbjct: 132 KASSYGEVVQHAMGRPAR 149 >emb|CBI36435.3| unnamed protein product [Vitis vinifera] Length = 465 Score = 97.1 bits (240), Expect = 1e-18 Identities = 55/78 (70%), Positives = 59/78 (75%) Frame = -2 Query: 234 GSGISGAVFNLTTSIIGAGIMALPATMKXXXXXXXXXXXXXXXXLSEISVELLVRFSVQC 55 GSGISGAVFNLTTSIIGAGIMALPATMK LSEISVELL+RFSV Sbjct: 54 GSGISGAVFNLTTSIIGAGIMALPATMKILGVVLGFVLIVLMGILSEISVELLLRFSVLN 113 Query: 54 KATSYGEIVQAALGRTAR 1 KA+SYGE+VQ ALGR+AR Sbjct: 114 KASSYGEVVQCALGRSAR 131