BLASTX nr result
ID: Scutellaria24_contig00027380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00027380 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597933.1| WD repeat-containing protein, putative [Medi... 65 4e-09 ref|XP_004165893.1| PREDICTED: LOW QUALITY PROTEIN: protein TOPL... 62 4e-08 ref|XP_004152185.1| PREDICTED: protein TOPLESS-like [Cucumis sat... 62 4e-08 ref|XP_004139298.1| PREDICTED: topless-related protein 4-like [C... 62 4e-08 gb|AAF27128.1|AC018849_16 unknown protein; 52184-57536 [Arabidop... 62 4e-08 >ref|XP_003597933.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355486981|gb|AES68184.1| WD repeat-containing protein, putative [Medicago truncatula] Length = 1149 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 192 GFEEELVGMSSLSRELVFLILQFLDEEKFKETVHKLEQE 308 GF+++ V MSSLSRELVFLILQFL+EEKFKE VHKLEQE Sbjct: 8 GFQDKGVAMSSLSRELVFLILQFLEEEKFKEAVHKLEQE 46 >ref|XP_004165893.1| PREDICTED: LOW QUALITY PROTEIN: protein TOPLESS-like [Cucumis sativus] Length = 1139 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 216 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 308 MSSLSRELVFLILQFLDEEKFKETVHKLEQE Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 31 >ref|XP_004152185.1| PREDICTED: protein TOPLESS-like [Cucumis sativus] Length = 1139 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 216 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 308 MSSLSRELVFLILQFLDEEKFKETVHKLEQE Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 31 >ref|XP_004139298.1| PREDICTED: topless-related protein 4-like [Cucumis sativus] Length = 1134 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 216 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 308 MSSLSRELVFLILQFLDEEKFKETVHKLEQE Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 31 >gb|AAF27128.1|AC018849_16 unknown protein; 52184-57536 [Arabidopsis thaliana] Length = 1073 Score = 62.4 bits (150), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 216 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 308 MSSLSRELVFLILQFLDEEKFKETVHKLEQE Sbjct: 1 MSSLSRELVFLILQFLDEEKFKETVHKLEQE 31