BLASTX nr result
ID: Scutellaria24_contig00027270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00027270 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002873759.1| peptidyl-tRNA hydrolase family protein [Arab... 58 9e-07 >ref|XP_002873759.1| peptidyl-tRNA hydrolase family protein [Arabidopsis lyrata subsp. lyrata] gi|297319596|gb|EFH50018.1| peptidyl-tRNA hydrolase family protein [Arabidopsis lyrata subsp. lyrata] Length = 239 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%) Frame = +3 Query: 57 PSCYWLHAGKISLFRSPRIKAMASISSEAER---PQKPWLLVGLGNPGKRYSGTRHN 218 P+ Y H K +FR PR + +S S+E +R PWL+VGLGNPG +Y GTRHN Sbjct: 8 PTIYHFHTQK-PVFRKPRFRVCSSTSTENDRFKVEYTPWLIVGLGNPGNKYHGTRHN 63