BLASTX nr result
ID: Scutellaria24_contig00027244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00027244 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282837.2| PREDICTED: GTPase Der-like [Vitis vinifera] 67 2e-09 emb|CBI16384.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|NP_187815.2| GTP-binding protein [Arabidopsis thaliana] gi|2... 60 2e-07 ref|NP_001078139.1| GTP-binding protein [Arabidopsis thaliana] g... 60 2e-07 dbj|BAD93758.1| hypothetical protein [Arabidopsis thaliana] 60 2e-07 >ref|XP_002282837.2| PREDICTED: GTPase Der-like [Vitis vinifera] Length = 676 Score = 67.0 bits (162), Expect = 2e-09 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 5/76 (6%) Frame = -2 Query: 214 DEQTSSDDEEEAEN----LDVLELERQANLAVKEYSDSLSRQLKIEDEVSNQKRTR-GKP 50 D+ DD+EE N LDV LE +A AV+EYS LSRQL IE++ +N+ + R GK Sbjct: 98 DDDDDDDDDEEVANRSYSLDVDALEEEAKHAVREYSRFLSRQLSIEEDGANELKGRGGKQ 157 Query: 49 KQRTVTTSNVPDHLLP 2 K+ TT N+PDHLLP Sbjct: 158 KKSKSTTRNIPDHLLP 173 >emb|CBI16384.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 62.8 bits (151), Expect = 3e-08 Identities = 39/77 (50%), Positives = 49/77 (63%), Gaps = 6/77 (7%) Frame = -2 Query: 214 DEQTSSDDEEEAEN----LDVLELERQANLAVKEYSDSLSRQLKIEDEVSNQKRTR-GKP 50 D+ DD+EE N LDV LE +A AV+EYS LSRQL IE++ +N+ + R GK Sbjct: 112 DDDDDDDDDEEVANRSYSLDVDALEEEAKHAVREYSRFLSRQLSIEEDGANELKGRGGKQ 171 Query: 49 KQRTVTTSNV-PDHLLP 2 K+ TT NV PDHLLP Sbjct: 172 KKSKSTTRNVIPDHLLP 188 >ref|NP_187815.2| GTP-binding protein [Arabidopsis thaliana] gi|209529777|gb|ACI49783.1| At3g12080 [Arabidopsis thaliana] gi|332641625|gb|AEE75146.1| GTP-binding protein [Arabidopsis thaliana] Length = 663 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = -2 Query: 217 YDEQTSSDD--EEEAENLDVLELERQANLAVKEYSDSLSRQLKIEDEVSNQKRTRGKPKQ 44 Y E +DD ++E +++D+ LE++A V++Y+ +LSR+LKIEDE K TR K K+ Sbjct: 86 YAEDNFADDYSDDEDDSIDISVLEKEARDIVRDYATTLSRELKIEDETIEGKETRRKGKR 145 Query: 43 RTVTTSNVPDHLL 5 T +P+HLL Sbjct: 146 LAKNTQQIPEHLL 158 >ref|NP_001078139.1| GTP-binding protein [Arabidopsis thaliana] gi|332641626|gb|AEE75147.1| GTP-binding protein [Arabidopsis thaliana] Length = 587 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = -2 Query: 217 YDEQTSSDD--EEEAENLDVLELERQANLAVKEYSDSLSRQLKIEDEVSNQKRTRGKPKQ 44 Y E +DD ++E +++D+ LE++A V++Y+ +LSR+LKIEDE K TR K K+ Sbjct: 86 YAEDNFADDYSDDEDDSIDISVLEKEARDIVRDYATTLSRELKIEDETIEGKETRRKGKR 145 Query: 43 RTVTTSNVPDHLL 5 T +P+HLL Sbjct: 146 LAKNTQQIPEHLL 158 >dbj|BAD93758.1| hypothetical protein [Arabidopsis thaliana] Length = 370 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = -2 Query: 217 YDEQTSSDD--EEEAENLDVLELERQANLAVKEYSDSLSRQLKIEDEVSNQKRTRGKPKQ 44 Y E +DD ++E +++D+ LE++A V++Y+ +LSR+LKIEDE K TR K K+ Sbjct: 86 YAEDNFADDYSDDEDDSIDISVLEKEARDIVRDYATTLSRELKIEDETIEGKETRRKGKR 145 Query: 43 RTVTTSNVPDHLL 5 T +P+HLL Sbjct: 146 LAKNTQQIPEHLL 158