BLASTX nr result
ID: Scutellaria24_contig00026881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026881 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF24608.1|AC010870_1 unknown protein [Arabidopsis thaliana] 59 4e-07 ref|NP_186786.2| CRM family member 2 [Arabidopsis thaliana] gi|2... 59 4e-07 >gb|AAF24608.1|AC010870_1 unknown protein [Arabidopsis thaliana] Length = 1020 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/73 (49%), Positives = 45/73 (61%), Gaps = 5/73 (6%) Frame = +1 Query: 61 RRRVSISAAAV----EAGSQALPQSAIKRIAEKLRSLGYV-XXXXXXNGEDEGLIGGPNS 225 RR VS + + + +G + LPQSAI+RIAEKLRSLG+V G G NS Sbjct: 34 RRNVSRANSGIFCSSASGRKTLPQSAIQRIAEKLRSLGFVEEKHDSPTRRITGEESGKNS 93 Query: 226 PGEIFMPLPSRLP 264 PGEIF+PLP +LP Sbjct: 94 PGEIFVPLPKQLP 106 >ref|NP_186786.2| CRM family member 2 [Arabidopsis thaliana] gi|22531018|gb|AAM97013.1| unknown protein [Arabidopsis thaliana] gi|37202002|gb|AAQ89616.1| At3g01370 [Arabidopsis thaliana] gi|332640136|gb|AEE73657.1| CRM family member 2 [Arabidopsis thaliana] Length = 1011 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/73 (49%), Positives = 45/73 (61%), Gaps = 5/73 (6%) Frame = +1 Query: 61 RRRVSISAAAV----EAGSQALPQSAIKRIAEKLRSLGYV-XXXXXXNGEDEGLIGGPNS 225 RR VS + + + +G + LPQSAI+RIAEKLRSLG+V G G NS Sbjct: 34 RRNVSRANSGIFCSSASGRKTLPQSAIQRIAEKLRSLGFVEEKHDSPTRRITGEESGKNS 93 Query: 226 PGEIFMPLPSRLP 264 PGEIF+PLP +LP Sbjct: 94 PGEIFVPLPKQLP 106