BLASTX nr result
ID: Scutellaria24_contig00026771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026771 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265811.2| PREDICTED: pyrophosphate-energized membrane ... 56 3e-06 >ref|XP_002265811.2| PREDICTED: pyrophosphate-energized membrane proton pump 3 [Vitis vinifera] Length = 895 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 103 LLNFTGTVTQLKIQRPGSGGDLPQTGEFNPFPVA 2 +L FT +T KIQRPGSGGDLPQ+GEF PFPVA Sbjct: 52 ILTFTVCITTFKIQRPGSGGDLPQSGEFIPFPVA 85