BLASTX nr result
ID: Scutellaria24_contig00026579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026579 (521 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77490.1| hypothetical protein VITISV_010725 [Vitis vinifera] 57 2e-06 >emb|CAN77490.1| hypothetical protein VITISV_010725 [Vitis vinifera] Length = 569 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 4/94 (4%) Frame = -2 Query: 298 MAASVQFRPQNRDLGMVMREVDEDLAIFLGIQNAEKERNDRRLVDESDVFDSSKSAEAEV 119 M SV R+L MVM+E DE+L +FL ++ EKE+ND L++ D SK + + Sbjct: 1 MPVSVLGEQPERNLRMVMKEKDEELLLFLEMRRREKEKNDSLLLESPDAPFGSKPDVSPI 60 Query: 118 VCLLAS----NASQDNLLDLEMEKKDDNWLISQP 29 +++S D LLD E ++ D +WL++ P Sbjct: 61 SKIVSSMPVRKTGPDELLDSENDRTDYDWLLTPP 94