BLASTX nr result
ID: Scutellaria24_contig00026492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026492 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD33126.2| RNA-directed DNA polymerase (Reverse transcriptas... 70 1e-10 ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding sub... 67 4e-10 ref|XP_003604260.1| CNGC5-like protein [Medicago truncatula] gi|... 69 5e-10 gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptas... 67 2e-09 gb|AAB48348.1| reverse transcriptase, partial [Arabidopsis thali... 65 4e-09 >gb|ABD33126.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 653 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -2 Query: 247 SFPEALNDTNVVLIPKCDNRATLEDLRPISLCYVLYKIISKVLADRLIKLL 95 + P AL DTN+VLIPKCD+ T+ DLRPISLC V+YKI++K LA+RL ++L Sbjct: 71 NLPTALGDTNIVLIPKCDHPRTMRDLRPISLCNVVYKILAKTLANRLQRVL 121 >ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] gi|355513943|gb|AES95566.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] Length = 1723 Score = 67.0 bits (162), Expect(2) = 4e-10 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = -2 Query: 286 GRYIQNL--MFMQSLSFPEALNDTNVVLIPKCDNRATLEDLRPISLCYVLYKIISKVLAD 113 GRYI ++ + SFP LN TN+ LIPK D +++++D RPI+LC VLYKI++KVLA+ Sbjct: 902 GRYIFEAACFWLDNGSFPSCLNSTNITLIPKGDTQSSMKDWRPIALCNVLYKIVAKVLAN 961 Query: 112 RL 107 RL Sbjct: 962 RL 963 Score = 21.9 bits (45), Expect(2) = 4e-10 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 50 IQYILKTCDSFAWEYL 3 IQYI D WEYL Sbjct: 998 IQYISTAYDRINWEYL 1013 >ref|XP_003604260.1| CNGC5-like protein [Medicago truncatula] gi|355505315|gb|AES86457.1| CNGC5-like protein [Medicago truncatula] Length = 1023 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/46 (63%), Positives = 41/46 (89%) Frame = -2 Query: 244 FPEALNDTNVVLIPKCDNRATLEDLRPISLCYVLYKIISKVLADRL 107 FP +LN+TN+ LIPKCD+ +++D+RPISLC VLYK++SK+LA+RL Sbjct: 85 FPSSLNETNICLIPKCDSPKSMKDMRPISLCNVLYKMLSKLLANRL 130 >gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 573 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = -2 Query: 262 FMQSLSFPEALNDTNVVLIPKCDNRATLEDLRPISLCYVLYKIISKVLADRLIKLL 95 ++ S SFP LN T++VL PK DN ++DLRPISLC VLYKIISKVLA+RL L+ Sbjct: 34 WLTSGSFPPELNATHIVLAPKGDNPEYMKDLRPISLCNVLYKIISKVLANRLRPLI 89 >gb|AAB48348.1| reverse transcriptase, partial [Arabidopsis thaliana] Length = 199 Score = 65.5 bits (158), Expect = 4e-09 Identities = 34/63 (53%), Positives = 43/63 (68%) Frame = -2 Query: 283 RYIQNLMFMQSLSFPEALNDTNVVLIPKCDNRATLEDLRPISLCYVLYKIISKVLADRLI 104 + +QN F S SF E LN+TN+ LIPK D + + RPISLC V YK+ISKVL+ RL Sbjct: 25 KVVQN--FHSSASFDERLNETNICLIPKIDRPRRMAEFRPISLCNVSYKVISKVLSSRLK 82 Query: 103 KLL 95 K+L Sbjct: 83 KIL 85