BLASTX nr result
ID: Scutellaria24_contig00026455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026455 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69975.1| hypothetical protein VITISV_020776 [Vitis vinifera] 65 7e-09 ref|XP_003526898.1| PREDICTED: uncharacterized LOC547938 [Glycin... 64 1e-08 gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phase... 64 1e-08 sp|P83399.1|DEF1_VIGUN RecName: Full=Defensin-like protein 1; Al... 64 1e-08 ref|XP_002272913.2| PREDICTED: defensin-like protein 6-like [Vit... 64 1e-08 >emb|CAN69975.1| hypothetical protein VITISV_020776 [Vitis vinifera] Length = 74 Score = 64.7 bits (156), Expect = 7e-09 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -1 Query: 261 RTCESPSQEYAGRCNSDHNCGMVCRNEGFTGGWCRAPPRRCF 136 R CES S ++ G C DHNC +VCRNEGF+GG C+ RRCF Sbjct: 28 RVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGXRRRCF 69 >ref|XP_003526898.1| PREDICTED: uncharacterized LOC547938 [Glycine max] gi|509769|emb|CAA79164.1| seed-specific low molecular weight sulfur-rich protein [Glycine max] Length = 75 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -1 Query: 261 RTCESPSQEYAGRCNSDHNCGMVCRNEGFTGGWCRAPPRRCF 136 R CES S + G CN DHNC +VCRNEGF+GG C+ RRCF Sbjct: 29 RVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCF 70 >gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus] Length = 73 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -1 Query: 261 RTCESPSQEYAGRCNSDHNCGMVCRNEGFTGGWCRAPPRRCF 136 R CES S + G C DHNC +VCRNEGF+GG CR RRCF Sbjct: 27 RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCF 68 >sp|P83399.1|DEF1_VIGUN RecName: Full=Defensin-like protein 1; AltName: Full=Cp-thionin I; AltName: Full=Cp-thionin-1; AltName: Full=Gamma-thionin I Length = 47 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -1 Query: 261 RTCESPSQEYAGRCNSDHNCGMVCRNEGFTGGWCRAPPRRCF 136 R CES S + G C DHNC +VCRNEGF+GG CR RRCF Sbjct: 1 RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCF 42 >ref|XP_002272913.2| PREDICTED: defensin-like protein 6-like [Vitis vinifera] gi|296084806|emb|CBI27688.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -1 Query: 261 RTCESPSQEYAGRCNSDHNCGMVCRNEGFTGGWCRAPPRRCF 136 R CES S ++ G C DHNC +VCRNEGF+GG C+ RRCF Sbjct: 29 RVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCF 70