BLASTX nr result
ID: Scutellaria24_contig00026454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026454 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21426.3| unnamed protein product [Vitis vinifera] 89 3e-16 ref|XP_002282505.1| PREDICTED: uncharacterized protein LOC100262... 89 3e-16 ref|XP_002877740.1| hypothetical protein ARALYDRAFT_485385 [Arab... 89 5e-16 ref|XP_002523586.1| conserved hypothetical protein [Ricinus comm... 89 5e-16 ref|NP_190603.1| uncharacterized protein [Arabidopsis thaliana] ... 89 5e-16 >emb|CBI21426.3| unnamed protein product [Vitis vinifera] Length = 372 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/53 (75%), Positives = 51/53 (96%) Frame = -1 Query: 338 LKADRFSETLRKGGWSSDEVAEALGFDFRREEEKKPAKKLSPEMVERLGKLAE 180 LKADRFS++LRK GWSS+EV++ALGFD+R E+E+KPAKKL+PE+VER+GKLAE Sbjct: 307 LKADRFSDSLRKAGWSSEEVSDALGFDYRPEKERKPAKKLAPELVERIGKLAE 359 >ref|XP_002282505.1| PREDICTED: uncharacterized protein LOC100262755 [Vitis vinifera] Length = 397 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/53 (75%), Positives = 51/53 (96%) Frame = -1 Query: 338 LKADRFSETLRKGGWSSDEVAEALGFDFRREEEKKPAKKLSPEMVERLGKLAE 180 LKADRFS++LRK GWSS+EV++ALGFD+R E+E+KPAKKL+PE+VER+GKLAE Sbjct: 340 LKADRFSDSLRKAGWSSEEVSDALGFDYRPEKERKPAKKLAPELVERIGKLAE 392 >ref|XP_002877740.1| hypothetical protein ARALYDRAFT_485385 [Arabidopsis lyrata subsp. lyrata] gi|297323578|gb|EFH53999.1| hypothetical protein ARALYDRAFT_485385 [Arabidopsis lyrata subsp. lyrata] Length = 403 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -1 Query: 338 LKADRFSETLRKGGWSSDEVAEALGFDFRREEEKKPAKKLSPEMVERLGKLAE 180 LKA RFSE+LRK GWSS+EV++ALGFDFR E+EKKP KKLSPE+V+R+GKLAE Sbjct: 346 LKAGRFSESLRKAGWSSEEVSDALGFDFRPEKEKKPVKKLSPELVQRIGKLAE 398 >ref|XP_002523586.1| conserved hypothetical protein [Ricinus communis] gi|223537148|gb|EEF38781.1| conserved hypothetical protein [Ricinus communis] Length = 398 Score = 88.6 bits (218), Expect = 5e-16 Identities = 39/53 (73%), Positives = 50/53 (94%) Frame = -1 Query: 338 LKADRFSETLRKGGWSSDEVAEALGFDFRREEEKKPAKKLSPEMVERLGKLAE 180 LKADRFS++LRK GWSS+EV++ALGFDFR E+E+KP KKLSPE++E++GKLAE Sbjct: 341 LKADRFSDSLRKAGWSSEEVSDALGFDFRPEKERKPVKKLSPELIEKIGKLAE 393 >ref|NP_190603.1| uncharacterized protein [Arabidopsis thaliana] gi|6523045|emb|CAB62313.1| putative protein [Arabidopsis thaliana] gi|28416689|gb|AAO42875.1| At3g50340 [Arabidopsis thaliana] gi|110743322|dbj|BAE99549.1| hypothetical protein [Arabidopsis thaliana] gi|332645134|gb|AEE78655.1| uncharacterized protein [Arabidopsis thaliana] Length = 403 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -1 Query: 338 LKADRFSETLRKGGWSSDEVAEALGFDFRREEEKKPAKKLSPEMVERLGKLAE 180 LKA RFSE+LRK GWSS+EV++ALGFDFR E+EKKP KKLSPE+V+R+GKLAE Sbjct: 346 LKAGRFSESLRKAGWSSEEVSDALGFDFRPEKEKKPVKKLSPELVQRIGKLAE 398