BLASTX nr result
ID: Scutellaria24_contig00026349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026349 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307356.1| predicted protein [Populus trichocarpa] gi|2... 75 7e-12 ref|XP_002512343.1| ring finger protein, putative [Ricinus commu... 73 3e-11 gb|AFW73525.1| putative RING zinc finger domain superfamily prot... 72 6e-11 gb|AFW73524.1| putative RING zinc finger domain superfamily prot... 72 6e-11 ref|XP_003534006.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 72 6e-11 >ref|XP_002307356.1| predicted protein [Populus trichocarpa] gi|222856805|gb|EEE94352.1| predicted protein [Populus trichocarpa] Length = 436 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = -2 Query: 330 LRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQPWHTNDMESEL 160 LRL+PKC+H+FHP+C+ AWL H+TCPVCRANL P G P P H +D +++L Sbjct: 156 LRLIPKCSHVFHPDCIDAWLTSHVTCPVCRANLVPKPGDLPF---NPVHVDDPKNDL 209 >ref|XP_002512343.1| ring finger protein, putative [Ricinus communis] gi|223548304|gb|EEF49795.1| ring finger protein, putative [Ricinus communis] Length = 380 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 2/58 (3%) Frame = -2 Query: 330 LRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQ--PWHTNDMESE 163 LRLLPKC+H+FHP+C+ AWL H TCPVCR+NL P P + T+ P ++D+E++ Sbjct: 136 LRLLPKCDHVFHPDCIDAWLASHTTCPVCRSNLTPQPVDPPTQTTESLPDSSSDLEAQ 193 >gb|AFW73525.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 419 Score = 71.6 bits (174), Expect = 6e-11 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 330 LRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDP 226 LRLLPKC+H FHPEC+G WL H+TCPVCR NLDP Sbjct: 139 LRLLPKCSHAFHPECIGEWLASHVTCPVCRCNLDP 173 >gb|AFW73524.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 502 Score = 71.6 bits (174), Expect = 6e-11 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 330 LRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDP 226 LRLLPKC+H FHPEC+G WL H+TCPVCR NLDP Sbjct: 139 LRLLPKCSHAFHPECIGEWLASHVTCPVCRCNLDP 173 >ref|XP_003534006.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Glycine max] Length = 362 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = -2 Query: 330 LRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQPWHTND 175 LRLLPKCNH+FHP C+ +WL H+TCPVCRANL + H V T P H + Sbjct: 140 LRLLPKCNHVFHPHCIDSWLACHVTCPVCRANLSQESSH--VSITVPPHNEE 189