BLASTX nr result
ID: Scutellaria24_contig00026206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026206 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631143.1| Purple acid phosphatase [Medicago truncatula... 71 6e-21 ref|XP_003631144.1| Purple acid phosphatase [Medicago truncatula... 71 6e-21 gb|AAF60317.1|AF236109_1 putative purple acid phosphatase precur... 70 5e-19 ref|NP_001241371.1| uncharacterized protein LOC100817359 precurs... 67 7e-19 emb|CAE85073.1| putative acid phosphatase [Lupinus luteus] 64 6e-18 >ref|XP_003631143.1| Purple acid phosphatase [Medicago truncatula] gi|355525165|gb|AET05619.1| Purple acid phosphatase [Medicago truncatula] Length = 341 Score = 70.9 bits (172), Expect(2) = 6e-21 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 307 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSNH 444 DL TAL+ S A WKIVVGHHP+RSIG GDT ELL H+LPIL +N+ Sbjct: 206 DLETALRDSTAKWKIVVGHHPVRSIGHHGDTKELLTHLLPILEANN 251 Score = 54.7 bits (130), Expect(2) = 6e-21 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = +3 Query: 63 CKLSIF--SGLLQIFFIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 194 C+ S F + + + FF+DT PFVDKYF K + +K++W+GVLPR KYL Sbjct: 154 CQRSFFVHTEIAEFFFVDTTPFVDKYFLKPKDHKYDWRGVLPRKKYL 200 >ref|XP_003631144.1| Purple acid phosphatase [Medicago truncatula] gi|355525166|gb|AET05620.1| Purple acid phosphatase [Medicago truncatula] Length = 300 Score = 70.9 bits (172), Expect(2) = 6e-21 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 307 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSNH 444 DL TAL+ S A WKIVVGHHP+RSIG GDT ELL H+LPIL +N+ Sbjct: 165 DLETALRDSTAKWKIVVGHHPVRSIGHHGDTKELLTHLLPILEANN 210 Score = 54.7 bits (130), Expect(2) = 6e-21 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = +3 Query: 63 CKLSIF--SGLLQIFFIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 194 C+ S F + + + FF+DT PFVDKYF K + +K++W+GVLPR KYL Sbjct: 113 CQRSFFVHTEIAEFFFVDTTPFVDKYFLKPKDHKYDWRGVLPRKKYL 159 >gb|AAF60317.1|AF236109_1 putative purple acid phosphatase precursor [Phaseolus vulgaris] Length = 331 Score = 69.7 bits (169), Expect(2) = 5e-19 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +1 Query: 307 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSN 441 DL ALK S A WKIVVGHHP+RSIG GDT EL++H+LPIL +N Sbjct: 189 DLEIALKDSTAKWKIVVGHHPVRSIGHHGDTQELIRHLLPILEAN 233 Score = 49.3 bits (116), Expect(2) = 5e-19 Identities = 21/37 (56%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +3 Query: 87 LLQIFFIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 194 + + FF+DT PFVDKYF K + + ++W GVLPR KYL Sbjct: 147 IAEFFFVDTTPFVDKYFLKPKDHTYDWTGVLPRDKYL 183 >ref|NP_001241371.1| uncharacterized protein LOC100817359 precursor [Glycine max] gi|255640157|gb|ACU20369.1| unknown [Glycine max] Length = 329 Score = 66.6 bits (161), Expect(2) = 7e-19 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +1 Query: 307 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSNH 444 DL ALK S A WKIVVGHHP+RSIG GDT EL++ +LPIL N+ Sbjct: 191 DLEIALKDSTAKWKIVVGHHPVRSIGHHGDTKELIRQLLPILEENN 236 Score = 52.0 bits (123), Expect(2) = 7e-19 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +3 Query: 87 LLQIFFIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 194 + + FFID+ PFVDKYF K + +K++W+GVLPR KYL Sbjct: 149 IAEFFFIDSTPFVDKYFLKPKDHKYDWRGVLPREKYL 185 >emb|CAE85073.1| putative acid phosphatase [Lupinus luteus] Length = 330 Score = 64.3 bits (155), Expect(2) = 6e-18 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +1 Query: 307 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSN 441 DL A+K S A WKIVVGHH IRS+G GDT EL+K +LPIL N Sbjct: 195 DLELAIKESTAQWKIVVGHHAIRSVGHHGDTQELIKQLLPILQEN 239 Score = 51.2 bits (121), Expect(2) = 6e-18 Identities = 18/38 (47%), Positives = 31/38 (81%) Frame = +3 Query: 81 SGLLQIFFIDTNPFVDKYFFKQPNKFNWKGVLPRYKYL 194 S L++IFF+DT PFV+KYF + +K++W+G++P+ Y+ Sbjct: 152 SELVEIFFVDTTPFVEKYFTETKHKYDWQGIIPQKSYI 189