BLASTX nr result
ID: Scutellaria24_contig00026172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026172 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275052.2| PREDICTED: double-stranded RNA-binding prote... 99 3e-19 emb|CBI21312.3| unnamed protein product [Vitis vinifera] 99 3e-19 ref|XP_002298650.1| predicted protein [Populus trichocarpa] gi|2... 99 3e-19 emb|CAN71476.1| hypothetical protein VITISV_038619 [Vitis vinifera] 99 3e-19 ref|XP_002512890.1| double-stranded RNA binding protein, putativ... 99 4e-19 >ref|XP_002275052.2| PREDICTED: double-stranded RNA-binding protein 5 [Vitis vinifera] Length = 484 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +1 Query: 121 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFES 258 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FES Sbjct: 4 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFES 49 >emb|CBI21312.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +1 Query: 121 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFES 258 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FES Sbjct: 1 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFES 46 >ref|XP_002298650.1| predicted protein [Populus trichocarpa] gi|222845908|gb|EEE83455.1| predicted protein [Populus trichocarpa] Length = 357 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +1 Query: 121 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFES 258 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FES Sbjct: 1 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFES 46 >emb|CAN71476.1| hypothetical protein VITISV_038619 [Vitis vinifera] Length = 552 Score = 99.4 bits (246), Expect = 3e-19 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +1 Query: 121 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFES 258 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FES Sbjct: 72 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFES 117 >ref|XP_002512890.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223547901|gb|EEF49393.1| double-stranded RNA binding protein, putative [Ricinus communis] Length = 477 Score = 99.0 bits (245), Expect = 4e-19 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = +1 Query: 121 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFES 258 MFKNQLQELAQRSCFNLPSYAC+REGPDHAPRFKASVNFNGE+FES Sbjct: 4 MFKNQLQELAQRSCFNLPSYACVREGPDHAPRFKASVNFNGEIFES 49