BLASTX nr result
ID: Scutellaria24_contig00026170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00026170 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD72269.1| plastid fibrillin 3 [Coffea canephora] 62 6e-08 ref|XP_003560711.1| PREDICTED: probable plastid-lipid-associated... 58 9e-07 ref|XP_003547056.1| PREDICTED: probable plastid-lipid-associated... 58 9e-07 gb|ACJ85069.1| unknown [Medicago truncatula] gi|388518147|gb|AFK... 58 9e-07 ref|XP_003593086.1| hypothetical protein MTR_2g007640 [Medicago ... 58 9e-07 >gb|ABD72269.1| plastid fibrillin 3 [Coffea canephora] Length = 174 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 235 YLDEELRISRGNQGNLFILRMVDPLYRVPL 146 YLDEELRISRGNQGNLFILRMVDP YRVPL Sbjct: 145 YLDEELRISRGNQGNLFILRMVDPSYRVPL 174 >ref|XP_003560711.1| PREDICTED: probable plastid-lipid-associated protein 4, chloroplastic-like [Brachypodium distachyon] Length = 260 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 235 YLDEELRISRGNQGNLFILRMVDPLYRVPL 146 YLDEELR+SRG++GNLF+L+MVDP+YRVPL Sbjct: 230 YLDEELRVSRGDKGNLFVLKMVDPMYRVPL 259 >ref|XP_003547056.1| PREDICTED: probable plastid-lipid-associated protein 4, chloroplastic-like [Glycine max] Length = 245 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 235 YLDEELRISRGNQGNLFILRMVDPLYRVPL 146 YLDE+LRISRGN+GNLFIL+MVDP YRVPL Sbjct: 216 YLDEDLRISRGNRGNLFILKMVDPSYRVPL 245 >gb|ACJ85069.1| unknown [Medicago truncatula] gi|388518147|gb|AFK47135.1| unknown [Medicago truncatula] Length = 248 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 235 YLDEELRISRGNQGNLFILRMVDPLYRVPL 146 YLDE+LRISRGN+GNLFIL+MVDP YRVPL Sbjct: 219 YLDEDLRISRGNRGNLFILKMVDPSYRVPL 248 >ref|XP_003593086.1| hypothetical protein MTR_2g007640 [Medicago truncatula] gi|124360438|gb|ABN08448.1| PAP fibrillin [Medicago truncatula] gi|355482134|gb|AES63337.1| hypothetical protein MTR_2g007640 [Medicago truncatula] Length = 248 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 235 YLDEELRISRGNQGNLFILRMVDPLYRVPL 146 YLDE+LRISRGN+GNLFIL+MVDP YRVPL Sbjct: 219 YLDEDLRISRGNRGNLFILKMVDPSYRVPL 248