BLASTX nr result
ID: Scutellaria24_contig00025977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025977 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553512.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic ... 87 1e-15 ref|NP_001237697.1| PDR-like ABC-transporter [Glycine max] gi|94... 87 1e-15 ref|XP_003625399.1| Pleiotropic drug resistance protein [Medicag... 86 4e-15 ref|XP_003569329.1| PREDICTED: pleiotropic drug resistance prote... 84 9e-15 ref|XP_002458139.1| hypothetical protein SORBIDRAFT_03g027510 [S... 84 9e-15 >ref|XP_003553512.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 3-like [Glycine max] Length = 748 Score = 87.0 bits (214), Expect = 1e-15 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +2 Query: 65 GMMVVAATPNLHIANIIAYAFYAVCGLFSGLFISRPKTPVWWRWFPWANPVAW 223 GMM VA TPN HI++I++ AFYAV LFSG + RP+ PVWWRW+ WANPVAW Sbjct: 624 GMMSVAVTPNQHISSIVSSAFYAVWNLFSGFIVPRPRIPVWWRWYSWANPVAW 676 >ref|NP_001237697.1| PDR-like ABC-transporter [Glycine max] gi|94732079|emb|CAK03587.1| PDR-like ABC-transporter [Glycine max] Length = 1447 Score = 87.0 bits (214), Expect = 1e-15 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +2 Query: 65 GMMVVAATPNLHIANIIAYAFYAVCGLFSGLFISRPKTPVWWRWFPWANPVAW 223 GMM VA TPN HI++I++ AFYAV LFSG + RP+ PVWWRW+ WANPVAW Sbjct: 1324 GMMSVAVTPNQHISSIVSSAFYAVWNLFSGFIVPRPRIPVWWRWYSWANPVAW 1376 >ref|XP_003625399.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500414|gb|AES81617.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1469 Score = 85.5 bits (210), Expect = 4e-15 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 65 GMMVVAATPNLHIANIIAYAFYAVCGLFSGLFISRPKTPVWWRWFPWANPVAW 223 GMM VA TPN HI+ I++ AFY+V LFSG + RP+ PVWWRW+ WANPVAW Sbjct: 1346 GMMAVAMTPNNHISTIVSSAFYSVWNLFSGFIVPRPRIPVWWRWYSWANPVAW 1398 >ref|XP_003569329.1| PREDICTED: pleiotropic drug resistance protein 3-like [Brachypodium distachyon] Length = 1450 Score = 84.3 bits (207), Expect = 9e-15 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 65 GMMVVAATPNLHIANIIAYAFYAVCGLFSGLFISRPKTPVWWRWFPWANPVAW 223 GMM + TPN HIA+I++ AFYA+ LFSG I RPKTP+WWRW+ W PVAW Sbjct: 1330 GMMAIGLTPNYHIASIVSSAFYAIWNLFSGFIIPRPKTPIWWRWYCWVCPVAW 1382 >ref|XP_002458139.1| hypothetical protein SORBIDRAFT_03g027510 [Sorghum bicolor] gi|241930114|gb|EES03259.1| hypothetical protein SORBIDRAFT_03g027510 [Sorghum bicolor] Length = 1453 Score = 84.3 bits (207), Expect = 9e-15 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +2 Query: 65 GMMVVAATPNLHIANIIAYAFYAVCGLFSGLFISRPKTPVWWRWFPWANPVAW 223 GMM V TPN HIA+I++ AFYA+ LFSG I RPKTP+WWRW+ W PVAW Sbjct: 1330 GMMAVGLTPNYHIASIVSSAFYAIWNLFSGFIIPRPKTPIWWRWYCWICPVAW 1382