BLASTX nr result
ID: Scutellaria24_contig00025862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025862 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197403.2| mitochondrial editing factor 18 [Arabidopsis th... 97 3e-22 ref|XP_002277532.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-21 emb|CBI26175.3| unnamed protein product [Vitis vinifera] 98 1e-21 ref|XP_004150326.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-21 ref|XP_002516788.1| pentatricopeptide repeat-containing protein,... 94 2e-21 >ref|NP_197403.2| mitochondrial editing factor 18 [Arabidopsis thaliana] gi|223635651|sp|P0C8Q8.1|PP394_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g19020, mitochondrial; Flags: Precursor gi|332005257|gb|AED92640.1| mitochondrial editing factor 18 [Arabidopsis thaliana] Length = 685 Score = 97.4 bits (241), Expect(2) = 3e-22 Identities = 45/72 (62%), Positives = 57/72 (79%) Frame = +3 Query: 9 HAEVSLRIFTDLQSRAINPNSITFTGVLSVCSHAG*VEAGERHFKSMKIIYGLEPDIHHY 188 HA+++L +++DLQS I PNSITF GVLS C HAG VE G+ +F+SMK +G+EPDI HY Sbjct: 522 HAKLALDLYSDLQSLPIKPNSITFVGVLSACCHAGLVELGKTYFESMKSDHGIEPDIKHY 581 Query: 189 NCMVDMLGWAGR 224 CMVD+LG AGR Sbjct: 582 GCMVDLLGKAGR 593 Score = 32.3 bits (72), Expect(2) = 3e-22 Identities = 13/19 (68%), Positives = 18/19 (94%) Frame = +1 Query: 211 GGLEEAEELVKRMPMKADV 267 G LEEA+E++K+MP+KADV Sbjct: 592 GRLEEAKEMIKKMPVKADV 610 >ref|XP_002277532.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial [Vitis vinifera] Length = 694 Score = 97.8 bits (242), Expect(2) = 1e-21 Identities = 44/72 (61%), Positives = 55/72 (76%) Frame = +3 Query: 9 HAEVSLRIFTDLQSRAINPNSITFTGVLSVCSHAG*VEAGERHFKSMKIIYGLEPDIHHY 188 HA VSL++F+ LQ I PNSITF GVLS C HAG V+ GE++FK MK +Y +EP+I HY Sbjct: 531 HANVSLKLFSQLQRVRIKPNSITFIGVLSACCHAGLVDTGEKYFKGMKNLYNIEPNIKHY 590 Query: 189 NCMVDMLGWAGR 224 CM+D+LG AGR Sbjct: 591 GCMIDLLGRAGR 602 Score = 30.4 bits (67), Expect(2) = 1e-21 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +1 Query: 211 GGLEEAEELVKRMPMKADV 267 G L+EA E++++MPMKADV Sbjct: 601 GRLKEAAEMIRKMPMKADV 619 >emb|CBI26175.3| unnamed protein product [Vitis vinifera] Length = 619 Score = 97.8 bits (242), Expect(2) = 1e-21 Identities = 44/72 (61%), Positives = 55/72 (76%) Frame = +3 Query: 9 HAEVSLRIFTDLQSRAINPNSITFTGVLSVCSHAG*VEAGERHFKSMKIIYGLEPDIHHY 188 HA VSL++F+ LQ I PNSITF GVLS C HAG V+ GE++FK MK +Y +EP+I HY Sbjct: 456 HANVSLKLFSQLQRVRIKPNSITFIGVLSACCHAGLVDTGEKYFKGMKNLYNIEPNIKHY 515 Query: 189 NCMVDMLGWAGR 224 CM+D+LG AGR Sbjct: 516 GCMIDLLGRAGR 527 Score = 30.4 bits (67), Expect(2) = 1e-21 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +1 Query: 211 GGLEEAEELVKRMPMKADV 267 G L+EA E++++MPMKADV Sbjct: 526 GRLKEAAEMIRKMPMKADV 544 >ref|XP_004150326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial-like [Cucumis sativus] Length = 874 Score = 95.5 bits (236), Expect(2) = 2e-21 Identities = 46/74 (62%), Positives = 56/74 (75%) Frame = +3 Query: 9 HAEVSLRIFTDLQSRAINPNSITFTGVLSVCSHAG*VEAGERHFKSMKIIYGLEPDIHHY 188 HA +SL IF++LQ R+I NSITF GVLS C HAG VE GER+F SMK +G+EP+I HY Sbjct: 711 HANLSLEIFSNLQRRSIKLNSITFLGVLSACCHAGLVEVGERYFWSMKTQHGVEPNIKHY 770 Query: 189 NCMVDMLGWAGRSR 230 C+VD+LG GR R Sbjct: 771 GCLVDLLGRVGRLR 784 Score = 31.6 bits (70), Expect(2) = 2e-21 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +1 Query: 211 GGLEEAEELVKRMPMKADV 267 G L EAEE+V+ MPMKADV Sbjct: 781 GRLREAEEIVRTMPMKADV 799 >ref|XP_002516788.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543876|gb|EEF45402.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 710 Score = 94.0 bits (232), Expect(2) = 2e-21 Identities = 43/72 (59%), Positives = 55/72 (76%) Frame = +3 Query: 9 HAEVSLRIFTDLQSRAINPNSITFTGVLSVCSHAG*VEAGERHFKSMKIIYGLEPDIHHY 188 HA +SL+IF+DL+ R I N+ITF GVL+ C H G VE+G+RHF SMK + ++PDI HY Sbjct: 545 HANLSLKIFSDLERRHIKLNAITFIGVLTACCHVGLVESGKRHFMSMKSEHSIDPDIKHY 604 Query: 189 NCMVDMLGWAGR 224 CMVD+LG AGR Sbjct: 605 GCMVDLLGRAGR 616 Score = 33.1 bits (74), Expect(2) = 2e-21 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +1 Query: 211 GGLEEAEELVKRMPMKADV 267 G LEEAEE+++ MPMKADV Sbjct: 615 GRLEEAEEMIRSMPMKADV 633