BLASTX nr result
ID: Scutellaria24_contig00025694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025694 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 102 3e-20 dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] 99 5e-19 ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulg... 60 2e-07 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 102 bits (254), Expect = 3e-20 Identities = 50/57 (87%), Positives = 51/57 (89%) Frame = -3 Query: 317 RSSKGSRRPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFGIQFDIFLGRYREGVGM 147 RSSKGSRRPTK RK GSFRK IPIRRVHN MDKLTLTRQFGI F IFLGRYREG+GM Sbjct: 86 RSSKGSRRPTKARKSGSFRKWIPIRRVHNRMDKLTLTRQFGIHFGIFLGRYREGIGM 142 >dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] Length = 174 Score = 98.6 bits (244), Expect = 5e-19 Identities = 50/58 (86%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = -3 Query: 317 RSSKGSRRPTKVRKPGSFRKRIPIRRVHNCMDKLTLTRQFG-IQFDIFLGRYREGVGM 147 RSSKGSRRPTK RKPGS RK IPIRRVHN MDKLTLTRQFG IQF IFLGRYR+G+GM Sbjct: 117 RSSKGSRRPTKARKPGSVRKWIPIRRVHNRMDKLTLTRQFGMIQFGIFLGRYRKGIGM 174 >ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435087|ref|YP_004222305.1| hypothetical protein BevumaM_p070 [Beta vulgaris subsp. maritima] gi|346683178|ref|YP_004842110.1| hypothetical protein BemaM_p065 [Beta macrocarpa] gi|9049278|dbj|BAA99288.1| orf114a [Beta vulgaris subsp. vulgaris] gi|317905640|emb|CBJ14041.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439820|emb|CBJ17532.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500096|emb|CBX24914.1| hypothetical protein [Beta macrocarpa] gi|384977899|emb|CBL54123.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 114 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 226 MQLCTLRIGIRFLKDPGFRTLVGLRDPFDDL 318 M+LCTLRIGI FL DPGFR LVGLRDPFDDL Sbjct: 1 MRLCTLRIGIHFLTDPGFRALVGLRDPFDDL 31