BLASTX nr result
ID: Scutellaria24_contig00025693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025693 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] 69 5e-10 ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulg... 66 3e-09 emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 65 7e-09 gb|ABV02394.1| hypothetical chloroplast RF15 [Ipomoea purpurea] ... 55 6e-06 >dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] Length = 174 Score = 68.6 bits (166), Expect = 5e-10 Identities = 44/76 (57%), Positives = 48/76 (63%), Gaps = 6/76 (7%) Frame = +3 Query: 6 TETKCRTGANSSSRKKGLTKPGSLTNTNL-----I**KRTVFSVYFPRFRCYRGL-YAID 167 TETKCR GANSSSRKKGLT+PGSLTNTNL I K +F + P R L + Sbjct: 48 TETKCRAGANSSSRKKGLTEPGSLTNTNLIENTNIIEKNCLFCILSPVLLLPRALRNRSE 107 Query: 168 RIR*ISLQHRSSKGSR 215 I S QHRSSKGSR Sbjct: 108 HIDIPSTQHRSSKGSR 123 >ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435087|ref|YP_004222305.1| hypothetical protein BevumaM_p070 [Beta vulgaris subsp. maritima] gi|346683178|ref|YP_004842110.1| hypothetical protein BemaM_p065 [Beta macrocarpa] gi|9049278|dbj|BAA99288.1| orf114a [Beta vulgaris subsp. vulgaris] gi|317905640|emb|CBJ14041.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439820|emb|CBJ17532.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500096|emb|CBX24914.1| hypothetical protein [Beta macrocarpa] gi|384977899|emb|CBL54123.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 114 Score = 66.2 bits (160), Expect = 3e-09 Identities = 40/76 (52%), Positives = 47/76 (61%), Gaps = 6/76 (7%) Frame = -2 Query: 214 RDPFDDLC*RD-IYLIRSIA*SPR*QRNRGKYTEKT-----VLFYYIRLVLVSDPGLVSP 53 RDPFDDLC + I + R + G+ +K +L + IRLVLVSDPG VSP Sbjct: 25 RDPFDDLCCVEGISICSDRLRKARGSKRTGESIQKRQFFSIILVFSIRLVLVSDPGSVSP 84 Query: 52 FFRDELLAPVLHFVSV 5 FFRDELLAP HFVSV Sbjct: 85 FFRDELLAPARHFVSV 100 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 89 SNIIEKNCLFCILPPVPLLSRALRNRSD*IDIPST 193 +NIIEKNCLFCIL PVPLL RALRNRSD IDIPST Sbjct: 49 TNIIEKNCLFCILSPVPLLPRALRNRSDHIDIPST 83 Score = 59.7 bits (143), Expect = 2e-07 Identities = 39/65 (60%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 24 TGANSSSRKKGLTKPGSLTNTNLI**KRTVFSVYFPRFRCYRGL-YAIDRIR*ISLQHRS 200 TGANSSSRKKGLT+PGSLTNTN+I K +F + P R L D I S QHRS Sbjct: 29 TGANSSSRKKGLTEPGSLTNTNII-EKNCLFCILSPVPLLPRALRNRSDHIDIPSTQHRS 87 Query: 201 SKGSR 215 SKGSR Sbjct: 88 SKGSR 92 >gb|ABV02394.1| hypothetical chloroplast RF15 [Ipomoea purpurea] gi|157056820|gb|ABV02410.1| hypothetical chloroplast RF15 [Ipomoea purpurea] Length = 56 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 4 PQRQNVGLVPTVHHGRKDSLSRDH 75 PQRQNVGLVPTVHHGRKDSLSRDH Sbjct: 33 PQRQNVGLVPTVHHGRKDSLSRDH 56