BLASTX nr result
ID: Scutellaria24_contig00025602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025602 (1069 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199615.1| ubiquitin carboxyl-terminal hydrolase-like prot... 61 5e-07 gb|AAU44577.1| hypothetical protein AT5G48040 [Arabidopsis thali... 61 5e-07 >ref|NP_199615.1| ubiquitin carboxyl-terminal hydrolase-like protein [Arabidopsis thaliana] gi|10177755|dbj|BAB11068.1| unnamed protein product [Arabidopsis thaliana] gi|55740679|gb|AAV63932.1| hypothetical protein At5g48040 [Arabidopsis thaliana] gi|332008230|gb|AED95613.1| ubiquitin carboxyl-terminal hydrolase-like protein [Arabidopsis thaliana] Length = 422 Score = 60.8 bits (146), Expect = 5e-07 Identities = 32/68 (47%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Frame = +3 Query: 9 LIEKHPLAEVREKYACLMKDGFLDRSRGLYKQERKASMAE-MVRFPFKGGFESEPETDCG 185 LIEKHPL EVREK+A +M +GFLDRSRGLY++ +A + + ++ + + E E D Sbjct: 344 LIEKHPLVEVREKFANMMNEGFLDRSRGLYQKSVEADLEKNNIKTSYPVWSDEEEELDNN 403 Query: 186 LLSD*ESD 209 L+S +SD Sbjct: 404 LISGYDSD 411 >gb|AAU44577.1| hypothetical protein AT5G48040 [Arabidopsis thaliana] Length = 422 Score = 60.8 bits (146), Expect = 5e-07 Identities = 32/68 (47%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Frame = +3 Query: 9 LIEKHPLAEVREKYACLMKDGFLDRSRGLYKQERKASMAE-MVRFPFKGGFESEPETDCG 185 LIEKHPL EVREK+A +M +GFLDRSRGLY++ +A + + ++ + + E E D Sbjct: 344 LIEKHPLVEVREKFANMMNEGFLDRSRGLYQKSVEADLEKNNIKTSYPVWSDEEEELDNN 403 Query: 186 LLSD*ESD 209 L+S +SD Sbjct: 404 LISGYDSD 411