BLASTX nr result
ID: Scutellaria24_contig00025557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025557 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524385.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_003535511.1| PREDICTED: protein IDA-like [Glycine max] 57 1e-06 ref|XP_003556256.1| PREDICTED: protein IDA-LIKE 1-like [Glycine ... 55 5e-06 >ref|XP_002524385.1| conserved hypothetical protein [Ricinus communis] gi|223536346|gb|EEF37996.1| conserved hypothetical protein [Ricinus communis] Length = 96 Score = 60.1 bits (144), Expect = 2e-07 Identities = 39/88 (44%), Positives = 50/88 (56%), Gaps = 6/88 (6%) Frame = -2 Query: 482 SRKMISIVVFLICFLLLSSCTEAARPGRTMMMTRKEDDVAAAMALKYFK-DHQKK-DIDG 309 S MI + F+ L +SSC AARPG T+M+ ++ M + K DH+K D Sbjct: 12 SCNMILCLFFIFSVLAVSSCVNAARPGVTLMVDKR-----VLMQSETTKPDHRKLYDTSF 66 Query: 308 LY----FTRLPKGVPIPPSAPSNRHNSL 237 +Y F LPKGVPIPPS PS RHNS+ Sbjct: 67 MYRNQMFNFLPKGVPIPPSGPSKRHNSI 94 >ref|XP_003535511.1| PREDICTED: protein IDA-like [Glycine max] Length = 94 Score = 57.4 bits (137), Expect = 1e-06 Identities = 34/83 (40%), Positives = 44/83 (53%) Frame = -2 Query: 476 KMISIVVFLICFLLLSSCTEAARPGRTMMMTRKEDDVAAAMALKYFKDHQKKDIDGLYFT 297 K S+ + L+ LL+ SCT A R G TM + + L+ + + GL F Sbjct: 15 KSFSMAILLVYLLLVGSCT-AIRTGATMRLNEGSE------LLRRKQQQPRFPYKGLVFN 67 Query: 296 RLPKGVPIPPSAPSNRHNSLPPS 228 LPKGVPIPPS PS RHNS+ S Sbjct: 68 FLPKGVPIPPSGPSKRHNSVVAS 90 >ref|XP_003556256.1| PREDICTED: protein IDA-LIKE 1-like [Glycine max] Length = 94 Score = 55.5 bits (132), Expect = 5e-06 Identities = 34/83 (40%), Positives = 42/83 (50%) Frame = -2 Query: 476 KMISIVVFLICFLLLSSCTEAARPGRTMMMTRKEDDVAAAMALKYFKDHQKKDIDGLYFT 297 K S+ + L LL+ SCT A R G TM + + L+ + + GL F Sbjct: 15 KAFSLAILLAFLLLVGSCT-ATRTGATMRLNEGSE------LLRPKQQKPRFPYKGLVFN 67 Query: 296 RLPKGVPIPPSAPSNRHNSLPPS 228 PKGVPIPPS PS RHNSL S Sbjct: 68 FFPKGVPIPPSGPSKRHNSLVAS 90