BLASTX nr result
ID: Scutellaria24_contig00025519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025519 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ06951.1| hypothetical protein OsI_29193 [Oryza sativa Indi... 55 5e-06 ref|XP_003083136.1| Speckle-type POZ protein SPOP and related pr... 55 6e-06 >gb|EAZ06951.1| hypothetical protein OsI_29193 [Oryza sativa Indica Group] Length = 394 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/55 (45%), Positives = 34/55 (61%) Frame = -1 Query: 220 STRMVKGIHRFTLENYSICKRLNQGSPIRSSSFEIGGHEWVVLVFVNGTERLNKG 56 ST +V+G H FT+ YS+ KR G IRS SFE+GG+ WVV + G + +G Sbjct: 27 STELVRGSHEFTVAGYSLQKRKGAGHSIRSGSFEVGGYRWVVQFYPAGESKEEEG 81 >ref|XP_003083136.1| Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains (ISS) [Ostreococcus tauri] gi|116055014|emb|CAL57091.1| Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains (ISS) [Ostreococcus tauri] Length = 619 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/60 (40%), Positives = 35/60 (58%) Frame = -1 Query: 235 SAPESSTRMVKGIHRFTLENYSICKRLNQGSPIRSSSFEIGGHEWVVLVFVNGTERLNKG 56 +A +ST V G H T+ YS+ K + G PI S F +GGHEWV+L + +G ++ G Sbjct: 34 AASRTSTTTVIGRHEHTISGYSLLKGIGDGEPIASDRFMVGGHEWVLLFYPDGKRSMSDG 93