BLASTX nr result
ID: Scutellaria24_contig00025458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025458 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004151859.1| PREDICTED: zinc finger with UFM1-specific pe... 100 9e-20 emb|CBI23122.3| unnamed protein product [Vitis vinifera] 99 3e-19 ref|XP_002269574.1| PREDICTED: uncharacterized protein LOC100250... 99 3e-19 ref|XP_003615491.1| Zinc finger with UFM1-specific peptidase dom... 99 4e-19 ref|XP_004169289.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 98 8e-19 >ref|XP_004151859.1| PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like [Cucumis sativus] Length = 450 Score = 100 bits (250), Expect = 9e-20 Identities = 46/77 (59%), Positives = 60/77 (77%), Gaps = 2/77 (2%) Frame = -3 Query: 225 LVLSQKKEIFYTVEGGLMTMLRKCLELESGNSTNVLCGHIDHFQST--WDVGWGCGWRNI 52 L+ SQ + FY VEGGLM++L+ CLELES +ST++L G++DH+QS D GWGCGWRNI Sbjct: 100 LIGSQNRGAFYKVEGGLMSLLKNCLELESHDSTSILSGYVDHYQSIEFEDFGWGCGWRNI 159 Query: 51 QMLSSHLIRQRKEARDV 1 QML SHL+ QR E R++ Sbjct: 160 QMLCSHLLMQRPETRNI 176 >emb|CBI23122.3| unnamed protein product [Vitis vinifera] Length = 404 Score = 99.4 bits (246), Expect = 3e-19 Identities = 50/83 (60%), Positives = 58/83 (69%), Gaps = 2/83 (2%) Frame = -3 Query: 243 DKPCASLVLSQKKEIFYTVEGGLMTMLRKCLELESGNSTNVLCGHIDHFQS--TWDVGWG 70 D+ L Q + FY VE GLM +LR CLE E GNST +L G + HFQS + DVGWG Sbjct: 90 DEKVFHLARLQIRSTFYRVEDGLMALLRNCLESELGNSTCILSGSVIHFQSIESEDVGWG 149 Query: 69 CGWRNIQMLSSHLIRQRKEARDV 1 CGWRNIQMLSSHL+ QR+EAR V Sbjct: 150 CGWRNIQMLSSHLVMQRQEARQV 172 >ref|XP_002269574.1| PREDICTED: uncharacterized protein LOC100250322 [Vitis vinifera] Length = 446 Score = 99.4 bits (246), Expect = 3e-19 Identities = 50/83 (60%), Positives = 58/83 (69%), Gaps = 2/83 (2%) Frame = -3 Query: 243 DKPCASLVLSQKKEIFYTVEGGLMTMLRKCLELESGNSTNVLCGHIDHFQS--TWDVGWG 70 D+ L Q + FY VE GLM +LR CLE E GNST +L G + HFQS + DVGWG Sbjct: 101 DEKVFHLARLQIRSTFYRVEDGLMALLRNCLESELGNSTCILSGSVIHFQSIESEDVGWG 160 Query: 69 CGWRNIQMLSSHLIRQRKEARDV 1 CGWRNIQMLSSHL+ QR+EAR V Sbjct: 161 CGWRNIQMLSSHLVMQRQEARQV 183 >ref|XP_003615491.1| Zinc finger with UFM1-specific peptidase domain protein [Medicago truncatula] gi|355516826|gb|AES98449.1| Zinc finger with UFM1-specific peptidase domain protein [Medicago truncatula] Length = 442 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/83 (56%), Positives = 60/83 (72%), Gaps = 2/83 (2%) Frame = -3 Query: 243 DKPCASLVLSQKKEIFYTVEGGLMTMLRKCLELESGNSTNVLCGHIDHFQSTW--DVGWG 70 D+ + LV Q K F+ V GGLM +LR CLE + NS ++L G++DHFQS DVGWG Sbjct: 78 DEKISCLVDLQIKGEFHNVNGGLMNLLRNCLESDGDNSRSILSGYVDHFQSNKFEDVGWG 137 Query: 69 CGWRNIQMLSSHLIRQRKEARDV 1 CGWRNIQMLSSHL+ Q++E +DV Sbjct: 138 CGWRNIQMLSSHLLAQKRETKDV 160 >ref|XP_004169289.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger with UFM1-specific peptidase domain protein-like [Cucumis sativus] Length = 450 Score = 97.8 bits (242), Expect = 8e-19 Identities = 45/77 (58%), Positives = 59/77 (76%), Gaps = 2/77 (2%) Frame = -3 Query: 225 LVLSQKKEIFYTVEGGLMTMLRKCLELESGNSTNVLCGHIDHFQST--WDVGWGCGWRNI 52 L+ SQ + F VEGGLM++L+ CLELES +ST++L G++DH+QS D GWGCGWRNI Sbjct: 100 LIGSQNRGAFXKVEGGLMSLLKNCLELESHDSTSILSGYVDHYQSIEFEDFGWGCGWRNI 159 Query: 51 QMLSSHLIRQRKEARDV 1 QML SHL+ QR E R++ Sbjct: 160 QMLCSHLLMQRPETRNI 176