BLASTX nr result
ID: Scutellaria24_contig00025346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025346 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054550.1| hypothetical protein NitaCp076 [Nicotiana tabac... 85 5e-15 ref|YP_001109551.1| hypothetical protein Poptr_cp073 [Populus tr... 72 5e-11 ref|NP_054551.1| hypothetical protein NitaCp077 [Nicotiana tabac... 67 2e-09 gb|AAO18644.1| hypothetical protein [Lactuca sativa] gi|66865841... 65 7e-09 ref|YP_001152246.1| ORF67g [Pinus koraiensis] gi|145048871|gb|AB... 60 1e-07 >ref|NP_054550.1| hypothetical protein NitaCp076 [Nicotiana tabacum] gi|11466024|ref|NP_054566.1| hypothetical protein NitaCp092 [Nicotiana tabacum] gi|78102590|ref|YP_358729.1| hypothetical protein NisyCp085 [Nicotiana sylvestris] gi|78102609|ref|YP_358748.1| hypothetical protein NisyCp106 [Nicotiana sylvestris] gi|81301620|ref|YP_398915.1| hypothetical protein NitoCp084 [Nicotiana tomentosiformis] gi|81301639|ref|YP_398934.1| hypothetical protein NitoCp105 [Nicotiana tomentosiformis] gi|351653932|ref|YP_004891658.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653950|ref|YP_004891677.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11879|emb|CAA77392.1| hypothetical protein [Nicotiana tabacum] gi|1223680|emb|CAA77401.1| hypothetical protein [Nicotiana tabacum] gi|77799617|dbj|BAE46706.1| hypothetical protein [Nicotiana sylvestris] gi|77799636|dbj|BAE46725.1| hypothetical protein [Nicotiana sylvestris] gi|80750979|dbj|BAE48055.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750998|dbj|BAE48074.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453958|gb|AEO95616.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453976|gb|AEO95634.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|225249|prf||1211235CH ORF 131 Length = 131 Score = 85.1 bits (209), Expect = 5e-15 Identities = 46/55 (83%), Positives = 47/55 (85%), Gaps = 3/55 (5%) Frame = +3 Query: 324 MKRMVKIGFNCQLPL---GLTSDSEGTGVTSPFHFHSRVLMCFHAPLRPRKMDKF 479 MK MVKIGFNCQLPL GLT+DSEGTGVTS FH SRVLM FHAPLRPRKMDKF Sbjct: 1 MKIMVKIGFNCQLPLSEIGLTTDSEGTGVTSLFH--SRVLMRFHAPLRPRKMDKF 53 >ref|YP_001109551.1| hypothetical protein Poptr_cp073 [Populus trichocarpa] gi|134093267|ref|YP_001109568.1| hypothetical protein Poptr_cp090 [Populus trichocarpa] gi|133712112|gb|ABO36755.1| conserved hypothetical protein [Populus trichocarpa] gi|133712129|gb|ABO36772.1| conserved hypothetical protein [Populus trichocarpa] Length = 86 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 481 KNLSIFRGLKGAWKHIRTLEWKWKGDVTPVPSE 383 +NLSIFRGLKGAWKHIRTLEWKWK DVTPVPSE Sbjct: 29 RNLSIFRGLKGAWKHIRTLEWKWKRDVTPVPSE 61 >ref|NP_054551.1| hypothetical protein NitaCp077 [Nicotiana tabacum] gi|11466025|ref|NP_054567.1| hypothetical protein NitaCp093 [Nicotiana tabacum] gi|78102591|ref|YP_358730.1| hypothetical protein NisyCp086 [Nicotiana sylvestris] gi|78102610|ref|YP_358749.1| hypothetical protein NisyCp107 [Nicotiana sylvestris] gi|81301621|ref|YP_398916.1| hypothetical protein NitoCp085 [Nicotiana tomentosiformis] gi|81301640|ref|YP_398935.1| hypothetical protein NitoCp106 [Nicotiana tomentosiformis] gi|351653933|ref|YP_004891659.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653951|ref|YP_004891678.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11878|emb|CAA77391.1| hypothetical protein [Nicotiana tabacum] gi|1223681|emb|CAA77402.1| hypothetical protein [Nicotiana tabacum] gi|77799618|dbj|BAE46707.1| hypothetical protein [Nicotiana sylvestris] gi|77799637|dbj|BAE46726.1| hypothetical protein [Nicotiana sylvestris] gi|80750980|dbj|BAE48056.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750999|dbj|BAE48075.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453959|gb|AEO95617.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453977|gb|AEO95635.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454069|gb|AEO95726.1| hypothetical protein [synthetic construct] gi|347454086|gb|AEO95743.1| hypothetical protein [synthetic construct] gi|225250|prf||1211235CJ ORF 70B Length = 70 Score = 66.6 bits (161), Expect = 2e-09 Identities = 35/44 (79%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = -2 Query: 481 KNLSIFRGLKGAWKHIRTLEWKWKGDVTPVPSESLVNP---RGS 359 +NLSIFRGLKGAWK IRTLE WK DVTPVPSES+VNP RGS Sbjct: 29 RNLSIFRGLKGAWKRIRTLE--WKRDVTPVPSESVVNPISDRGS 70 >gb|AAO18644.1| hypothetical protein [Lactuca sativa] gi|66865841|gb|AAY57522.1| unknown [Lactuca sativa] Length = 99 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/43 (72%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = -2 Query: 481 KNLSIFRGLKGAWKHIRTLEWKWKGDVTPVPSE---SLVNPRG 362 +NL IFR LKGAWKHIRTLEWKWK D TPVPSE SL +G Sbjct: 29 RNLYIFRDLKGAWKHIRTLEWKWKRDGTPVPSEMVRSLAQKKG 71 >ref|YP_001152246.1| ORF67g [Pinus koraiensis] gi|145048871|gb|ABP35486.1| ORF67g [Pinus koraiensis] Length = 67 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 205 GKGYNSAVECRLDVVEVISSSLIIPKPNVSFSI 107 GKGYNSAVEC LD+VEVISSSLIIPKPNVS SI Sbjct: 4 GKGYNSAVECHLDMVEVISSSLIIPKPNVSPSI 36