BLASTX nr result
ID: Scutellaria24_contig00025231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025231 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539691.1| PREDICTED: probable histone H2B.1-like isofo... 74 1e-11 ref|XP_003539693.1| PREDICTED: probable histone H2B.1-like [Glyc... 74 1e-11 gb|ACG41998.1| histone H2B.1 [Zea mays] 74 2e-11 ref|NP_001131457.1| uncharacterized protein LOC100192792 [Zea ma... 74 2e-11 ref|XP_003564232.1| PREDICTED: histone H2B.3-like isoform 1 [Bra... 73 2e-11 >ref|XP_003539691.1| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] gi|356542475|ref|XP_003539692.1| PREDICTED: probable histone H2B.1-like isoform 2 [Glycine max] Length = 149 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/47 (78%), Positives = 37/47 (78%) Frame = +1 Query: 127 GEGXXXXXXXXXSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN 267 GEG S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN Sbjct: 46 GEGGKKKKRNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN 92 >ref|XP_003539693.1| PREDICTED: probable histone H2B.1-like [Glycine max] gi|356542483|ref|XP_003539696.1| PREDICTED: probable histone H2B.1-like [Glycine max] Length = 149 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/47 (78%), Positives = 37/47 (78%) Frame = +1 Query: 127 GEGXXXXXXXXXSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN 267 GEG S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN Sbjct: 46 GEGGKKKKRNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN 92 >gb|ACG41998.1| histone H2B.1 [Zea mays] Length = 117 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/50 (76%), Positives = 38/50 (76%) Frame = +1 Query: 118 SVAGEGXXXXXXXXXSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN 267 S AGEG S ETYKIYIFKVLKQVHPDIGISSKAM IMNSFIN Sbjct: 44 SGAGEGKKGKKKAKKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIN 93 >ref|NP_001131457.1| uncharacterized protein LOC100192792 [Zea mays] gi|194691574|gb|ACF79871.1| unknown [Zea mays] gi|195640144|gb|ACG39540.1| histone H2B.1 [Zea mays] gi|413950452|gb|AFW83101.1| histone H2B isoform 1 [Zea mays] gi|413950453|gb|AFW83102.1| histone H2B isoform 2 [Zea mays] Length = 150 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/50 (76%), Positives = 38/50 (76%) Frame = +1 Query: 118 SVAGEGXXXXXXXXXSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN 267 S AGEG S ETYKIYIFKVLKQVHPDIGISSKAM IMNSFIN Sbjct: 44 SGAGEGKKGKKKAKKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIN 93 >ref|XP_003564232.1| PREDICTED: histone H2B.3-like isoform 1 [Brachypodium distachyon] gi|357125100|ref|XP_003564233.1| PREDICTED: histone H2B.3-like isoform 2 [Brachypodium distachyon] gi|357125102|ref|XP_003564234.1| PREDICTED: histone H2B.3-like isoform 3 [Brachypodium distachyon] gi|357125104|ref|XP_003564235.1| PREDICTED: histone H2B.3-like isoform 4 [Brachypodium distachyon] Length = 155 Score = 73.2 bits (178), Expect = 2e-11 Identities = 37/48 (77%), Positives = 37/48 (77%) Frame = +1 Query: 124 AGEGXXXXXXXXXSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIN 267 AGEG S ETYKIYIFKVLKQVHPDIGISSKAM IMNSFIN Sbjct: 51 AGEGKKGKKKAKKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIN 98