BLASTX nr result
ID: Scutellaria24_contig00025113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025113 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ93894.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 2e-06 ref|XP_003561596.1| PREDICTED: uncharacterized protein LOC100839... 56 3e-06 ref|NP_187969.1| calmodulin-binding protein-like protein [Arabid... 55 4e-06 gb|EEE59133.1| hypothetical protein OsJ_11025 [Oryza sativa Japo... 55 4e-06 gb|EEC75347.1| hypothetical protein OsI_11772 [Oryza sativa Indi... 55 4e-06 >dbj|BAJ93894.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 619 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 1 GAGPRIGCLRDYPSQLQSHALEQVKLSPR 87 GAGPRIGC+RDYPS+LQ+HALEQ+ LSPR Sbjct: 541 GAGPRIGCVRDYPSELQAHALEQMNLSPR 569 >ref|XP_003561596.1| PREDICTED: uncharacterized protein LOC100839575 [Brachypodium distachyon] Length = 668 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 1 GAGPRIGCLRDYPSQLQSHALEQVKLSPR 87 GAGPRIGC+RDYPS+LQ+HAL+Q+ LSPR Sbjct: 586 GAGPRIGCVRDYPSELQAHALQQMNLSPR 614 >ref|NP_187969.1| calmodulin-binding protein-like protein [Arabidopsis thaliana] gi|11994562|dbj|BAB02602.1| unnamed protein product [Arabidopsis thaliana] gi|332641860|gb|AEE75381.1| calmodulin-binding protein-like protein [Arabidopsis thaliana] Length = 605 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 GAGPRIGCLRDYPSQLQSHALEQVKLSPRS 90 GAGPRIGC+RDYPS+LQ ALEQV LSPRS Sbjct: 539 GAGPRIGCVRDYPSELQFQALEQVNLSPRS 568 >gb|EEE59133.1| hypothetical protein OsJ_11025 [Oryza sativa Japonica Group] Length = 621 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 GAGPRIGCLRDYPSQLQSHALEQVKLSPRS 90 GAGPRIGC+RDYPS+LQ ALEQV LSPRS Sbjct: 545 GAGPRIGCVRDYPSELQLRALEQVNLSPRS 574 >gb|EEC75347.1| hypothetical protein OsI_11772 [Oryza sativa Indica Group] Length = 622 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 GAGPRIGCLRDYPSQLQSHALEQVKLSPRS 90 GAGPRIGC+RDYPS+LQ ALEQV LSPRS Sbjct: 545 GAGPRIGCVRDYPSELQLRALEQVNLSPRS 574