BLASTX nr result
ID: Scutellaria24_contig00025000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00025000 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520976.1| DNA binding protein, putative [Ricinus commu... 54 1e-05 >ref|XP_002520976.1| DNA binding protein, putative [Ricinus communis] gi|223539813|gb|EEF41393.1| DNA binding protein, putative [Ricinus communis] Length = 299 Score = 54.3 bits (129), Expect = 1e-05 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -2 Query: 142 MANNPGETPSDDFLEQILGYPSYASAGDASNLVGND-APSAAMMLQL 5 MANNP E P+DDFL++ILG P++ASA DA+ LVG D A + MMLQL Sbjct: 1 MANNPTEPPADDFLQEILGLPNFASA-DAAGLVGADGALATPMMLQL 46