BLASTX nr result
ID: Scutellaria24_contig00024929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024929 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534526.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|NP_001185076.1| Putative thiol-disulfide oxidoreductase DCC ... 55 6e-06 ref|XP_002890605.1| RNase H domain-containing protein [Arabidops... 55 8e-06 >ref|XP_002534526.1| conserved hypothetical protein [Ricinus communis] gi|223525107|gb|EEF27856.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -3 Query: 141 ASTVLVDDAVADVPFPNVEAPFLLQRRVILYDGVCHLCHGGVKWIIK 1 A VL DA + +P P V P LLQ RV++YDGVCHLCH GVKW+IK Sbjct: 52 AGEVLYPDA-STLPSP-VTLPTLLQPRVVVYDGVCHLCHRGVKWVIK 96 >ref|NP_001185076.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi|9369400|gb|AAF87148.1|AC002423_13 T23E23.25 [Arabidopsis thaliana] gi|332192356|gb|AEE30477.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] Length = 213 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -3 Query: 135 TVLVDDAVADVPFPNVEAPFLLQRRVILYDGVCHLCHGGVKWIIK 1 T +D A + P V P LQ RV++YDGVCHLCHGGVKWIIK Sbjct: 51 TACLDPAESVTKIP-VIMPGNLQPRVVVYDGVCHLCHGGVKWIIK 94 >ref|XP_002890605.1| RNase H domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336447|gb|EFH66864.1| RNase H domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 536 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -3 Query: 126 VDDAVADVPFPNVEAPFLLQRRVILYDGVCHLCHGGVKWIIK 1 +D A + P V P LQ RV++YDGVCHLCHGGVKWIIK Sbjct: 377 LDPAESSTAIP-VIMPGNLQPRVVVYDGVCHLCHGGVKWIIK 417