BLASTX nr result
ID: Scutellaria24_contig00024913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024913 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144735.1| PREDICTED: transmembrane protein 184B-like [... 55 8e-06 >ref|XP_004144735.1| PREDICTED: transmembrane protein 184B-like [Cucumis sativus] Length = 420 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +2 Query: 278 PIYYILIALPCTVGAMTLVILHIHKHLSNYTEPTY 382 PIYY +IA CT GA+ L I HI++HL NYTEPTY Sbjct: 6 PIYYSIIAFFCTAGAIALAIFHIYRHLLNYTEPTY 40