BLASTX nr result
ID: Scutellaria24_contig00024890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024890 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545877.1| PREDICTED: C2 domain-containing protein At1g... 59 3e-07 ref|XP_002530135.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_003543167.1| PREDICTED: C2 domain-containing protein At1g... 58 7e-07 ref|XP_003543166.1| PREDICTED: C2 domain-containing protein At1g... 58 7e-07 ref|XP_004162104.1| PREDICTED: C2 domain-containing protein At1g... 58 9e-07 >ref|XP_003545877.1| PREDICTED: C2 domain-containing protein At1g53590-like [Glycine max] Length = 730 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/41 (58%), Positives = 36/41 (87%) Frame = +2 Query: 167 LESTILHHVCIVLIVLWLLNSFNCCNSVAYFASVIYLYMVH 289 +E +ILHHV IVL+ LW+L++FN C++VAYF ++IYL++VH Sbjct: 1 MEVSILHHVGIVLVGLWILSAFNWCHTVAYFVALIYLFLVH 41 >ref|XP_002530135.1| conserved hypothetical protein [Ricinus communis] gi|223530360|gb|EEF32251.1| conserved hypothetical protein [Ricinus communis] Length = 765 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +2 Query: 164 ILESTILHHVCIVLIVLWLLNSFNCCNSVAYFASVIYLYMVH 289 I E++I+HHV I+L VLWLL+ FN C+ A+F S+IYLY+VH Sbjct: 3 ITETSIMHHVGIILFVLWLLSYFNRCHPFAFFISLIYLYLVH 44 >ref|XP_003543167.1| PREDICTED: C2 domain-containing protein At1g53590-like isoform 2 [Glycine max] Length = 757 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/41 (58%), Positives = 35/41 (85%) Frame = +2 Query: 167 LESTILHHVCIVLIVLWLLNSFNCCNSVAYFASVIYLYMVH 289 +E +ILHH IVLI LW+L++FN C++VAYF ++IYL++VH Sbjct: 1 MEVSILHHAGIVLIGLWILSAFNWCHTVAYFVALIYLFLVH 41 >ref|XP_003543166.1| PREDICTED: C2 domain-containing protein At1g53590-like isoform 1 [Glycine max] Length = 766 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/41 (58%), Positives = 35/41 (85%) Frame = +2 Query: 167 LESTILHHVCIVLIVLWLLNSFNCCNSVAYFASVIYLYMVH 289 +E +ILHH IVLI LW+L++FN C++VAYF ++IYL++VH Sbjct: 1 MEVSILHHAGIVLIGLWILSAFNWCHTVAYFVALIYLFLVH 41 >ref|XP_004162104.1| PREDICTED: C2 domain-containing protein At1g53590-like [Cucumis sativus] Length = 731 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +2 Query: 167 LESTILHHVCIVLIVLWLLNSFNCCNSVAYFASVIYLYMVH 289 +E +I+ HV VL +LWLL++FNCC+ AYF S+IYLY+VH Sbjct: 1 MEVSIMIHVGFVLFLLWLLSAFNCCHVAAYFISLIYLYLVH 41