BLASTX nr result
ID: Scutellaria24_contig00024867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024867 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007507150.1| ribosomal protein S3 (chloroplast) [Salvia m... 105 4e-21 ref|YP_004935705.1| rps3 gene product (chloroplast) [Sesamum ind... 105 4e-21 gb|ADX99154.1| ribosomal protein S3 [Recordia boliviana] 105 4e-21 gb|ADX99149.1| ribosomal protein S3 [Tamonea boxiana] 105 4e-21 gb|ADX99141.1| ribosomal protein S3 [Lampayo castellani] 105 4e-21 >ref|YP_007507150.1| ribosomal protein S3 (chloroplast) [Salvia miltiorrhiza] gi|401879780|gb|AFQ30967.1| ribosomal protein S3 (chloroplast) [Salvia miltiorrhiza] Length = 220 Score = 105 bits (262), Expect = 4e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 3 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 152 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE Sbjct: 171 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 220 >ref|YP_004935705.1| rps3 gene product (chloroplast) [Sesamum indicum] gi|347448334|gb|AEO92745.1| ribosomal protein S3 (chloroplast) [Sesamum indicum] Length = 220 Score = 105 bits (262), Expect = 4e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 3 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 152 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE Sbjct: 171 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 220 >gb|ADX99154.1| ribosomal protein S3 [Recordia boliviana] Length = 193 Score = 105 bits (262), Expect = 4e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 3 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 152 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE Sbjct: 144 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 193 >gb|ADX99149.1| ribosomal protein S3 [Tamonea boxiana] Length = 196 Score = 105 bits (262), Expect = 4e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 3 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 152 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE Sbjct: 147 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 196 >gb|ADX99141.1| ribosomal protein S3 [Lampayo castellani] Length = 195 Score = 105 bits (262), Expect = 4e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 3 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 152 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE Sbjct: 146 KEIARVEWIREGRVPLQTIRAKIDYCSYTVRTIYGVLGIKIWIFIDKEEE 195