BLASTX nr result
ID: Scutellaria24_contig00024702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00024702 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453244.1| hypothetical protein SORBIDRAFT_04g002440 [S... 59 5e-07 >ref|XP_002453244.1| hypothetical protein SORBIDRAFT_04g002440 [Sorghum bicolor] gi|241933075|gb|EES06220.1| hypothetical protein SORBIDRAFT_04g002440 [Sorghum bicolor] Length = 322 Score = 58.5 bits (140), Expect = 5e-07 Identities = 40/102 (39%), Positives = 48/102 (47%), Gaps = 3/102 (2%) Frame = -3 Query: 341 FKMPFTNSPTVSGFPILFSPPSKSLGYSNGLFGIEKHKNVCRERRIVGRNLEMGFCAAAA 162 FK PF N + P S NG G+ + RN GF A Sbjct: 17 FKTPFVNKQASNWIPATIS---------NGTGGMFT---------VASRNSRNGFQVRAV 58 Query: 161 VGNGGS---FDVSFPSDYTQLLMQAKEATELALKDNKKLMSM 45 G+ GS DV FP+DYTQLLMQAKEA E A KD K+L+ + Sbjct: 59 TGDPGSRNASDVKFPTDYTQLLMQAKEAAESAFKDGKQLLEI 100